Align Crotonyl-CoA hydratase; EC 4.2.1.150 (characterized)
to candidate WP_011187497.1 DP_RS01255 1,4-dihydroxy-2-naphthoyl-CoA synthase
Query= SwissProt::Q0AVM1 (260 letters) >NCBI__GCF_000025945.1:WP_011187497.1 Length = 271 Score = 138 bits (347), Expect = 1e-37 Identities = 96/269 (35%), Positives = 147/269 (54%), Gaps = 28/269 (10%) Query: 3 YENIILEKEEKLAVLYINRPKAMNALNKDTLLEIKDAVTAVNDDPAVELLIITGSGDKSF 62 YE I E +A + INRP+ NA DT E+ +A+ + V ++I TG+GDK+F Sbjct: 10 YEEIKFEIFNGIAKITINRPRYYNAFTPDTNKEMLEAMVYCRECQDVRVVIFTGAGDKAF 69 Query: 63 VAGADIAFMQNLSAMEAREFGALGQK---------VFRLIEAMEKPVIAAVNGFALGGGC 113 AG D QN+ + G +G+ + + I ++ KPVIA VNGFA+GGG Sbjct: 70 CAGGD----QNVKSTG----GYIGKDGVPRLNVLDLQKAIRSLPKPVIAMVNGFAIGGGH 121 Query: 114 ELAMCCDFRIAASNAKFGQ--PEVGLGITPGFGGTQRLPRLVGPGMAKQLLYTADVINAD 171 L + CD IA+ NAKFGQ P+VG GFG + L R VG A+++ + D +A Sbjct: 122 VLHVVCDLTIASENAKFGQTGPKVG-SFDAGFGSSY-LARQVGQKKAREIWFLCDQYSAQ 179 Query: 172 EAFRIGLVNKVVQPEELLPEVKKIAGRILSKGQLAVRLSKAAANEGMQTDIDRAMSIE-- 229 EA +G+VNKVV E+L + +I+ + +A+R+ KA G+ ++D I+ Sbjct: 180 EAMDMGMVNKVVPLEQLEDTTVEWCEKIIKRSPMALRMIKA----GLNAELDGQAGIQEL 235 Query: 230 -ADAFGLCFATQDQKEGMTAFLEKRKANF 257 +A + + ++ +EG AFLEKR+ +F Sbjct: 236 AGNATMMFYMMEEAQEGKNAFLEKREPDF 264 Lambda K H 0.319 0.136 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 182 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 271 Length adjustment: 25 Effective length of query: 235 Effective length of database: 246 Effective search space: 57810 Effective search space used: 57810 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory