Align Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized)
to candidate WP_011188232.1 DP_RS04970 amino acid ABC transporter ATP-binding protein
Query= SwissProt::P17328 (400 letters) >NCBI__GCF_000025945.1:WP_011188232.1 Length = 244 Score = 165 bits (417), Expect = 1e-45 Identities = 93/236 (39%), Positives = 144/236 (61%), Gaps = 12/236 (5%) Query: 38 TGLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISD 97 +G +KD SL ++ E+ V++G SGSGKST +R LNRL G ++IDGV+I Sbjct: 15 SGTLHALKDVSLTVKPAEVVVVIGPSGSGKSTFLRCLNRLEYADAGSIVIDGVNILDPKC 74 Query: 98 AELREVRRKKIAMVFQSFALMPHMTVLDNTAFGMELAGIAAQERREK-----ALDALRQV 152 A R ++ MVFQSF L PH+TVL+N + +A I+ ++ R+ +++ L +V Sbjct: 75 AI--NAVRAEVGMVFQSFNLFPHITVLEN----ITMAQISVRKTRKAEADKISMELLEKV 128 Query: 153 GLENYAHAYPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQA 212 GL A AYPD+LSGG +QRV +AR+LA++P +LL DE SALDP + E+ D + L A Sbjct: 129 GLSQKAAAYPDQLSGGQQQRVAIARSLAMSPKVLLFDEPTSALDPEMVGEVLDVMQDL-A 187 Query: 213 KHQRTIVFISHDLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFFRGV 268 K T+V ++H++ A + DR+ M +G++ + G P+ NP N+ + F + + Sbjct: 188 KEGMTMVVVTHEMGFAREVADRVVFMDDGQIQEEGKPEHFFTNPQNERTKLFLKQI 243 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 244 Length adjustment: 27 Effective length of query: 373 Effective length of database: 217 Effective search space: 80941 Effective search space used: 80941 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory