Protein WP_011188232.1 in Desulfotalea psychrophila LSv54

Annotation: NCBI__GCF_000025945.1:WP_011188232.1

Length: 244 amino acids

Source: GCF_000025945.1 in NCBI

Candidate for 32 steps in catabolism of small carbon sources

Pathway	Step	Score	Similar to	Id.	Cov.	Bits	Other hit	Other id.	Other bits
L-histidine catabolism	aapP	med	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized)	62%	93%	297.4	Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.-	60%	294.7
L-glutamate catabolism	gltL	med	GluA aka CGL1950, component of Glutamate porter (characterized)	61%	99%	294.3	Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.-	60%	294.7
D-alanine catabolism	Pf6N2E2_5405	med	ABC transporter for D-Alanine, ATPase component (characterized)	60%	94%	290.8	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	62%	297.4
L-asparagine catabolism	aapP	med	AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)	60%	91%	290.8	Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.-	60%	294.7
L-aspartate catabolism	aapP	med	AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)	60%	91%	290.8	Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.-	60%	294.7
L-glutamate catabolism	aapP	med	AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)	60%	91%	290.8	Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.-	60%	294.7
L-leucine catabolism	aapP	med	AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)	60%	91%	290.8	Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.-	60%	294.7
L-proline catabolism	aapP	med	AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)	60%	91%	290.8	Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.-	60%	294.7
L-asparagine catabolism	bztD	med	BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)	60%	91%	290	Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.-	60%	294.7
L-aspartate catabolism	bztD	med	BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)	60%	91%	290	Glutamine transport ATP-binding protein GlnQ; EC 7.4.2.-	60%	294.7
L-asparagine catabolism	bgtA	med	ATPase (characterized, see rationale)	61%	92%	281.6	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	62%	297.4
L-aspartate catabolism	bgtA	med	ATPase (characterized, see rationale)	61%	92%	281.6	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	62%	297.4
L-asparagine catabolism	aatP	med	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component (characterized)	60%	99%	277.7	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	62%	297.4
L-aspartate catabolism	aatP	med	ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component (characterized)	60%	99%	277.7	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	62%	297.4
L-asparagine catabolism	glnQ	med	Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized)	57%	97%	271.2	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	62%	297.4
L-arginine catabolism	artP	med	Arginine transport ATP-binding protein ArtM (characterized)	57%	100%	268.9	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	62%	297.4
L-lysine catabolism	hisP	med	Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale)	54%	92%	264.6	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	62%	297.4
L-asparagine catabolism	peb1C	med	PEB1C, component of Uptake system for glutamate and aspartate (characterized)	54%	99%	260.4	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	62%	297.4
L-aspartate catabolism	peb1C	med	PEB1C, component of Uptake system for glutamate and aspartate (characterized)	54%	99%	260.4	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	62%	297.4
L-histidine catabolism	bgtA	med	BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)	54%	96%	254.6	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	62%	297.4
L-histidine catabolism	BPHYT_RS24015	med	ABC transporter related (characterized, see rationale)	51%	94%	245	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	62%	297.4
L-histidine catabolism	hisP	med	Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)	50%	96%	242.3	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	62%	297.4
D-glucosamine (chitosamine) catabolism	AO353_21725	med	ABC transporter for D-glucosamine, ATPase component (characterized)	50%	94%	238.4	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	62%	297.4
L-citrulline catabolism	AO353_03040	med	ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)	50%	98%	233.8	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	62%	297.4
L-citrulline catabolism	PS417_17605	med	ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale)	50%	90%	225.7	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	62%	297.4
L-histidine catabolism	PA5503	med	Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)	42%	72%	181.4	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	62%	297.4
L-histidine catabolism	hutV	med	HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)	42%	84%	164.9	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	62%	297.4
L-proline catabolism	hutV	med	HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)	42%	84%	164.9	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	62%	297.4
L-proline catabolism	proV	lo	Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized)	40%	58%	169.1	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	62%	297.4
L-proline catabolism	opuBA	lo	BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized)	40%	57%	160.6	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	62%	297.4
L-tryptophan catabolism	ecfA2	lo	Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale)	39%	80%	132.1	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	62%	297.4
L-proline catabolism	HSERO_RS00900	lo	ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)	31%	90%	103.6	ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component	62%	297.4

Sequence Analysis Tools

View WP_011188232.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MITAKNIHKYFETPSGTLHALKDVSLTVKPAEVVVVIGPSGSGKSTFLRCLNRLEYADAG
SIVIDGVNILDPKCAINAVRAEVGMVFQSFNLFPHITVLENITMAQISVRKTRKAEADKI
SMELLEKVGLSQKAAAYPDQLSGGQQQRVAIARSLAMSPKVLLFDEPTSALDPEMVGEVL
DVMQDLAKEGMTMVVVTHEMGFAREVADRVVFMDDGQIQEEGKPEHFFTNPQNERTKLFL
KQIL

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.