Align GluD aka CGL1953, component of Glutamate porter (characterized)
to candidate WP_011188233.1 DP_RS04975 amino acid ABC transporter permease
Query= TCDB::P48245 (273 letters) >NCBI__GCF_000025945.1:WP_011188233.1 Length = 336 Score = 110 bits (276), Expect = 3e-29 Identities = 66/210 (31%), Positives = 115/210 (54%), Gaps = 10/210 (4%) Query: 26 ILPGLWGTLKSAVFSVILALVMGTALGLGRISEIRILRWFCAVIIETFRAIPVLILMIFA 85 +L LW TLK + F++I+ + +G GL R+SE +L+WF + IE R P+++ + Sbjct: 126 LLISLWITLKVSFFAIIIGITLGILTGLSRVSENPLLKWFSIIYIELIRGTPLMVQIFLW 185 Query: 86 YQMFAQYNIVPS--SQLAFAAV------VFGLTMYNGSVIAEILRSGIASLPKGQKEAAI 137 Y F N++ + +Q+ V V L + G+ AEI+R+GI S+ +GQ EAA Sbjct: 186 Y--FVVGNLINAFLTQIGIGGVPPLWFGVIALATFTGAYTAEIVRAGIQSVHRGQMEAAR 243 Query: 138 ALGMSSRQTTWSILLPQAVAAMLPALISQMVIALKDSALGYQIGYIEVVRSGIQSASVNR 197 +LG++ ++ ++LPQA+ ++P L Q + +KDS+L I EV ++ + S + Sbjct: 244 SLGLTYAESMRKVILPQALRRIMPPLAGQFISLIKDSSLLGVIAIREVTKATREIVSSSL 303 Query: 198 NYLAALFVVALIMIVLNFSLTALASRIERQ 227 AL+ +VL F+L+ +ER+ Sbjct: 304 MPYEMWITCALLYLVLTFALSLCVQHLERK 333 Lambda K H 0.323 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 198 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 336 Length adjustment: 27 Effective length of query: 246 Effective length of database: 309 Effective search space: 76014 Effective search space used: 76014 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory