GapMind for catabolism of small carbon sources

 

Protein WP_011188233.1 in Desulfotalea psychrophila LSv54

Annotation: NCBI__GCF_000025945.1:WP_011188233.1

Length: 336 amino acids

Source: GCF_000025945.1 in NCBI

Candidate for 36 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-arginine catabolism bgtB lo Basic amino acid uptake transporter, BgtAB (characterized) 37% 51% 152.5 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-asparagine catabolism bgtA lo Basic amino acid uptake transporter, BgtAB (characterized) 37% 51% 152.5 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-aspartate catabolism bgtA lo Basic amino acid uptake transporter, BgtAB (characterized) 37% 51% 152.5 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-histidine catabolism bgtB lo Basic amino acid uptake transporter, BgtAB (characterized) 37% 51% 152.5 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-lysine catabolism bgtB lo Basic amino acid uptake transporter, BgtAB (characterized) 37% 51% 152.5 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-histidine catabolism Ac3H11_2554 lo ABC transporter for L-Histidine, permease component 1 (characterized) 36% 91% 146.4 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-asparagine catabolism natG lo NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 36% 78% 143.7 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-aspartate catabolism natG lo NatG, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 36% 78% 143.7 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-asparagine catabolism natH lo NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 36% 54% 136.7 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-aspartate catabolism natH lo NatH, component of Acidic and neutral amino acid uptake transporter NatFGH/BgtA. BgtA is shared with BgtAB (characterized) 36% 54% 136.7 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-asparagine catabolism aatM lo Glutamate/aspartate import permease protein GltK (characterized) 35% 99% 129.8 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-aspartate catabolism aatM lo Glutamate/aspartate import permease protein GltK (characterized) 35% 99% 129.8 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-glutamate catabolism gltK lo Glutamate/aspartate import permease protein GltK (characterized) 35% 99% 129.8 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-arginine catabolism artM lo AotP aka AotM aka PA0890, component of Arginine/ornithine (but not lysine) porter (characterized) 33% 89% 128.6 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-asparagine catabolism aatQ lo PP1070, component of Acidic amino acid uptake porter, AatJMQP (characterized) 35% 83% 128.3 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-aspartate catabolism aatQ lo PP1070, component of Acidic amino acid uptake porter, AatJMQP (characterized) 35% 83% 128.3 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-glutamate catabolism gltJ lo PP1070, component of Acidic amino acid uptake porter, AatJMQP (characterized) 35% 83% 128.3 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-lysine catabolism hisQ lo ABC transporter for L-Lysine, permease component 1 (characterized) 33% 90% 117.1 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
D-alanine catabolism Pf6N2E2_5404 lo ABC transporter for D-Alanine, permease component 1 (characterized) 33% 62% 116.3 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-histidine catabolism aapM lo ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, permease component 2 (characterized) 33% 53% 113.6 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-glutamate catabolism gluD lo GluD aka CGL1953, component of Glutamate porter (characterized) 31% 74% 113.2 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-asparagine catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 53% 110.9 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-aspartate catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 53% 110.9 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-glutamate catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 53% 110.9 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-leucine catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 53% 110.9 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-proline catabolism aapM lo AapM, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 53% 110.9 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-asparagine catabolism peb1D lo Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale) 30% 93% 109.4 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-aspartate catabolism peb1D lo Amino acid ABC transporter, permease protein PEB1 (characterized, see rationale) 30% 93% 109.4 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-glutamate catabolism gluC lo GluC aka CGL1952, component of Glutamate porter (characterized) 32% 95% 102.4 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-citrulline catabolism PS417_17600 lo ABC transporter permease; SubName: Full=Amino acid ABC transporter permease; SubName: Full=Histidine ABC transporter permease HisM; SubName: Full=Histidine transport system permease protein; SubName: Full=Histidine/lysine/arginine/ornithine ABC transporter permease HisM (characterized, see rationale) 31% 90% 101.3 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-asparagine catabolism aapQ lo AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 51% 84.7 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-aspartate catabolism aapQ lo AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 51% 84.7 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-glutamate catabolism aapQ lo AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 51% 84.7 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-histidine catabolism aapQ lo AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 51% 84.7 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-leucine catabolism aapQ lo AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 51% 84.7 Probable glutamine ABC transporter permease protein GlnM 40% 152.9
L-proline catabolism aapQ lo AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 32% 51% 84.7 Probable glutamine ABC transporter permease protein GlnM 40% 152.9

Sequence Analysis Tools

View WP_011188233.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSRYSGLDAPKSRGYFMFWRSAIVVCMLVVIGFTYVASSYVEYNWNWKQVPQYFWLDKTI
EVRAEVAGDIEKIIKGPEGYSISIMDGAYTETLQAPADAEILLTEGDYAYEGDLVASYKV
SQPGMLLISLWITLKVSFFAIIIGITLGILTGLSRVSENPLLKWFSIIYIELIRGTPLMV
QIFLWYFVVGNLINAFLTQIGIGGVPPLWFGVIALATFTGAYTAEIVRAGIQSVHRGQME
AARSLGLTYAESMRKVILPQALRRIMPPLAGQFISLIKDSSLLGVIAIREVTKATREIVS
SSLMPYEMWITCALLYLVLTFALSLCVQHLERKSLR

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory