Align High-affinity branched-chain amino acid transport system permease protein BraD, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_011188509.1 DP_RS06410 branched-chain amino acid ABC transporter permease
Query= TCDB::P21627 (307 letters) >NCBI__GCF_000025945.1:WP_011188509.1 Length = 296 Score = 153 bits (387), Expect = 4e-42 Identities = 100/295 (33%), Positives = 162/295 (54%), Gaps = 15/295 (5%) Query: 7 YLQQLVNGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYIAFIAITLLAMMGLD 66 ++Q L+ G+T GS YA++AIG+ ++Y G+INFA GE M+G ++I+LL M L Sbjct: 6 FVQYLLAGITYGSMYAIVAIGFNIIYNTTGIINFAQGEFVMLGG---MLSISLLQFMPL- 61 Query: 67 SVPLMMLAAFAASIIVTSAFGYSIERVAYRPLRGGNRLIPLISAIGMSIFLQNAVMLSQD 126 PL A ++++T A G +E + R L+ L ++ +G+SI L+ + Sbjct: 62 --PL----AIGLAVVLTMAVGGLVEILFIRWLKNPGVLRMIVITVGLSILLREIALHIWG 115 Query: 127 SKEKAIPTLLPGNFVFGESSMNGVVISYMQILIFVVTFLVMFGLTLFISRSRLGRACRAC 186 ++P GN + + G +S + + V L++ L LF S +GR RAC Sbjct: 116 EGVYSLPYFY-GNEI-STVVILGARVSPQILWVIGVCLLLVVLLHLFFKTSPMGREMRAC 173 Query: 187 AEDLKMTNLLGINSNNIIALTFVIGAALAAVA-AVLLGMQYGVINPGIGFLAGIKAFTAA 245 A + K L GIN+ N++ +F++ A + A+A AV+ + Y + G IK FT A Sbjct: 174 AVNKKAALLCGINARNMVTFSFMLSAGIGALAGAVMSPITYTQYDSGAAL--AIKGFTVA 231 Query: 246 VLGGIGSIPGAMLGGLLLGVAEAFGADVFGDQYKDVVAFGLLILVLLFRPTGILG 300 +LGG+G++ GA+ G+LLGV EAF V ++D +A LL+++L RP G+ G Sbjct: 232 ILGGLGNLFGAVAAGILLGVLEAFSVSVLPLAFQDAIAISLLLVILCVRPHGLFG 286 Lambda K H 0.328 0.145 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 245 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 296 Length adjustment: 27 Effective length of query: 280 Effective length of database: 269 Effective search space: 75320 Effective search space used: 75320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory