Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_011188511.1 DP_RS06420 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC78 (242 letters) >NCBI__GCF_000025945.1:WP_011188511.1 Length = 252 Score = 127 bits (320), Expect = 2e-34 Identities = 77/253 (30%), Positives = 140/253 (55%), Gaps = 25/253 (9%) Query: 9 LLQVKGLKVAYGGIQAVKGVDFEVREGELVSLIGSNGAGKTTTMKAITGTLSMNDGNIEY 68 LLQ+ GL A+GG+QA+K V F V+ G++ ++IG NGAGK+T I+GTL + G++ + Sbjct: 4 LLQIDGLSKAFGGLQALKNVSFAVKRGQIKAVIGPNGAGKSTLFNLISGTLKPSSGSVTF 63 Query: 69 LGKSIKGKGAWDLVKEGLVMVPEGRGVFARMTITENLQMGAYIRKDKAGILADIEKMFTI 128 +G+S+ GK + + + G+ + +F+ MT EN+ +G +I K ++G ++ + + Sbjct: 64 MGRSLLGKKPYQIAELGMARTFQNIKMFSAMTALENVMVGRHI-KSRSGFISSL----LM 118 Query: 129 FP-------RLRERKDQLAGTMSGGE-------------QQMLAMGRALMSQPKVLLLDE 168 P R+R++ L G++ GE Q+ + + RAL +P++LLLDE Sbjct: 119 SPWATREEGRIRDKSLALLGSLGLGEYAQVPAENLAFGQQRGVELARALALEPEILLLDE 178 Query: 169 PSMGLSPIMVDKIFEVVRDVYALGVTIVLVEQNASRALAIADRGYVMESGLITMTGPGQQ 228 P+ GL+ ++ ++ + +GVT++LVE + S + I+D V+ G + Sbjct: 179 PAAGLNIYETAELARMISAIRDMGVTVLLVEHDMSLVMDISDEILVLSFGQKIAEDIPRA 238 Query: 229 LLNDPKVRAAYLG 241 + + +V YLG Sbjct: 239 IQQNAEVIKIYLG 251 Lambda K H 0.317 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 252 Length adjustment: 24 Effective length of query: 218 Effective length of database: 228 Effective search space: 49704 Effective search space used: 49704 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory