Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate WP_011307343.1 MBAR_RS12630 glycine betaine/L-proline ABC transporter ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_09610 (276 letters) >NCBI__GCF_000195895.1:WP_011307343.1 Length = 506 Score = 309 bits (792), Expect = 7e-89 Identities = 150/262 (57%), Positives = 207/262 (79%) Query: 8 KIEVKNVFKIFGNRSKEALELIRQNKTKDQVLAETGCVVGVNDLSLSIGTGEIFVIMGLS 67 K+EV+N+ K+FG + + L+ + +K ++ +T VG+N+++ + GEIFVIMGLS Sbjct: 6 KLEVRNITKVFGKNPQRVISLLNEGFSKSEIFEKTKQTVGLNNVNFEVYEGEIFVIMGLS 65 Query: 68 GSGKSTLVRHFNRLIDPTSGAILVDGEDILQLDMDALREFRRHKISMVFQSFGLLPHKSV 127 GSGKSTL+R NRLI+PT+G IL+DG++I Q++ + LR+ RR +I MVFQ+F LLPHK V Sbjct: 66 GSGKSTLLRCLNRLIEPTAGEILIDGQNITQMNAEELRDVRRTRIGMVFQNFALLPHKIV 125 Query: 128 LDNVAYGLKVRGESKQVCAERALHWINTVGLKGYENKYPHQLSGGMRQRVGLARALAADT 187 LDNVAYGL+++G K+ +AL I TVGLKGYE+ +QLSGGM+QRVGLARALA D Sbjct: 126 LDNVAYGLEIQGIPKEERYSKALASIETVGLKGYEHSRINQLSGGMKQRVGLARALANDP 185 Query: 188 DIILMDEAFSALDPLIRAEMQDQLLELQKTLHKTIVFITHDLDEAVRIGNRIAILKDGKL 247 +I+LMDEAFSALDPLIR EMQD+L+ L+ + KTI+F++HDLDEA+++G+RIAI+KDG++ Sbjct: 186 EILLMDEAFSALDPLIRNEMQDELIALEDRVQKTIIFVSHDLDEALKLGDRIAIMKDGEV 245 Query: 248 IQVGTPREILHSPADEYVDRFV 269 +Q+GTP EIL PA+ YV +FV Sbjct: 246 VQIGTPEEILTEPANSYVSKFV 267 Lambda K H 0.321 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 351 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 506 Length adjustment: 30 Effective length of query: 246 Effective length of database: 476 Effective search space: 117096 Effective search space used: 117096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory