Align phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating) (EC 1.1.1.343) (characterized)
to candidate WP_011316750.1 AVA_RS28690 decarboxylating 6-phosphogluconate dehydrogenase
Query= BRENDA::G5EBD7 (332 letters) >NCBI__GCF_000204075.1:WP_011316750.1 Length = 337 Score = 341 bits (875), Expect = 1e-98 Identities = 178/345 (51%), Positives = 229/345 (66%), Gaps = 22/345 (6%) Query: 1 MRIGIIGLGRMGGNIAVRLTRHGHDVVVHDRTSEVTTSVVGRCEAGRATPADTLADMAKL 60 M +G+IGLGRMG N+A RLT+ GH V+ + R + +V R + +L Sbjct: 1 MELGMIGLGRMGANMAHRLTQAGHTVIGYTRQPQKAEVLVQEGAIARG-----VTSFVEL 55 Query: 61 LEG-DEHRVVWVMLPAGAITEDCVQQLGGLLGRGDIIIDGGNTYYKDDVRRSAELAEKGI 119 +E R VW+MLPA + + +Q L L DIIIDGGN+YY DD+RR+ +L KGI Sbjct: 56 IEALTPPRTVWLMLPAATV-DATLQTLIPFLDADDIIIDGGNSYYIDDIRRADQLKVKGI 114 Query: 120 SYVDVGTSGGVWGLERGYCMMFGGTKETAEYIDPILSALAPGIGDVPRTPGRDEAGHDPR 179 Y+D GTSGG+WG ERGYC+M GG +Y+DPI +ALAPG+ PRTPGR+ G Sbjct: 115 EYIDCGTSGGIWGAERGYCLMIGGALAVVKYLDPIFAALAPGVSAAPRTPGRELMGGT-- 172 Query: 180 AEQGYLHCGPAGSGHFVKMVHNGIEYGMMQAFAEGFDIMKSKN------------SPIL- 226 AEQGYLHCG G+GHFVKMVHNGIEYG+M A+AEG +I+ N +P+ Sbjct: 173 AEQGYLHCGSHGAGHFVKMVHNGIEYGIMAAYAEGLNILHHANIGKQLHQVDAETAPLRN 232 Query: 227 AEKDRFELNMGDIAEVWRRGSVVSSWLLDLTAEALTRSETLNEFSGEVADSGEGRWTIEA 286 E +++ N+ DIAEVWRRGSV+SSWLLDL A AL + L +F G V+DSGEGRWT+ A Sbjct: 233 PEFYQYDFNLADIAEVWRRGSVISSWLLDLIAMALVKDPDLTDFGGRVSDSGEGRWTLMA 292 Query: 287 AIEEDVPAPVMTAALFTRFRSRSGNNFAEKILSAQRFGFGGHVEK 331 AIEE VP PV++ AL+TRF SR + FA K++SA R+ FGGH+EK Sbjct: 293 AIEEAVPTPVLSTALYTRFSSRGQSEFANKLISALRYEFGGHLEK 337 Lambda K H 0.318 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 337 Length adjustment: 28 Effective length of query: 304 Effective length of database: 309 Effective search space: 93936 Effective search space used: 93936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_011316750.1 AVA_RS28690 (decarboxylating 6-phosphogluconate dehydrogenase)
to HMM TIGR00872 (gnd: 6-phosphogluconate dehydrogenase (decarboxylating) (EC 1.1.1.44))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00872.hmm # target sequence database: /tmp/gapView.25908.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00872 [M=299] Accession: TIGR00872 Description: gnd_rel: 6-phosphogluconate dehydrogenase (decarboxylating) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-126 405.6 0.0 7.2e-126 405.4 0.0 1.0 1 lcl|NCBI__GCF_000204075.1:WP_011316750.1 AVA_RS28690 decarboxylating 6-ph Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000204075.1:WP_011316750.1 AVA_RS28690 decarboxylating 6-phosphogluconate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 405.4 0.0 7.2e-126 7.2e-126 1 296 [. 1 337 [] 1 337 [] 0.97 Alignments for each domain: == domain 1 score: 405.4 bits; conditional E-value: 7.2e-126 TIGR00872 1 mklgliGlGrmGaniakrlakrghevvgydrdqdaveelkedr..aegvanlkellkrlsaprvvwvmv 67 m+lg+iGlGrmGan+a+rl++ gh v+gy r+++ e l +++ a gv++ el++ l++pr+vw+m+ lcl|NCBI__GCF_000204075.1:WP_011316750.1 1 MELGMIGLGRMGANMAHRLTQAGHTVIGYTRQPQKAEVLVQEGaiARGVTSFVELIEALTPPRTVWLML 69 89*******************************999999876511679********************* PP TIGR00872 68 pagivdavleelapllekGdividgGnsyykdslrrekelkekgihlldvGtsGGvlGkerGyclmiGG 136 pa+ vda l+ l p+l++ di+idgGnsyy d++rr +lk kgi+++d+GtsGG++G+erGyclmiGG lcl|NCBI__GCF_000204075.1:WP_011316750.1 70 PAATVDATLQTLIPFLDADDIIIDGGNSYYIDDIRRADQLKVKGIEYIDCGTSGGIWGAERGYCLMIGG 138 ********************************************************************* PP TIGR00872 137 deeafkkaeplfk.................dvaveekGylylGeaGsGhfvkmvhnGieyGlmaalaeG 188 + k +p+f+ + e+Gyl++G+ G+GhfvkmvhnGieyG+maa aeG lcl|NCBI__GCF_000204075.1:WP_011316750.1 139 ALAVVKYLDPIFAalapgvsaaprtpgrelMGGTAEQGYLHCGSHGAGHFVKMVHNGIEYGIMAAYAEG 207 ****************************764467899******************************** PP TIGR00872 189 levlkns......................qfdfdleevarvyrrGsvirsflldltakaleesadleev 235 l++l+++ q+df+l ++a+v+rrGsvi s+lldl+a al +++dl ++ lcl|NCBI__GCF_000204075.1:WP_011316750.1 208 LNILHHAnigkqlhqvdaetaplrnpefyQYDFNLADIAEVWRRGSVISSWLLDLIAMALVKDPDLTDF 276 ********************************************************************* PP TIGR00872 236 eGrvedsGeGrwtvkaavdlgvpapvlatslqerfasrekddfankvlaalrkefGghaek 296 Grv+dsGeGrwt aa+++ vp+pvl+t+l++rf+sr + +fank ++alr+efGgh ek lcl|NCBI__GCF_000204075.1:WP_011316750.1 277 GGRVSDSGEGRWTLMAAIEEAVPTPVLSTALYTRFSSRGQSEFANKLISALRYEFGGHLEK 337 **********************************************************876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (299 nodes) Target sequences: 1 (337 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 10.29 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory