Align 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 5.3.3.18) (characterized)
to candidate WP_011317058.1 AVA_RS00835 1,4-dihydroxy-2-naphthoyl-CoA synthase
Query= BRENDA::Q5SLK3 (254 letters) >NCBI__GCF_000204075.1:WP_011317058.1 Length = 277 Score = 102 bits (255), Expect = 6e-27 Identities = 84/272 (30%), Positives = 123/272 (45%), Gaps = 35/272 (12%) Query: 2 VLKERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGR------ 55 +L + DG+ +T+NRP K NA + + LY A + ED + +L TGAG Sbjct: 14 ILYHKADGMAKITINRPHKRNAFRPKTVFELYDAFCDAREDTNIGVVLFTGAGPHTDGKY 73 Query: 56 AFSAGQDLTEFGDRKPDYEAHLRRYN--RVVEALSGLEKPLVVAVNGVAAGAGMSLALWG 113 AF +G D + G +A + R N + + + K ++ V G A G G L L Sbjct: 74 AFCSGGDQSVRGQAGYVDDAGIPRLNVLDLQRLIRSMPKVVIALVAGYAIGGGHVLHLIC 133 Query: 114 DLRLAAVGASFTTAFVRIGLVPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLV 173 DL +AA A F ++G + L R+VG KA+E+ L + A++AL +GLV Sbjct: 134 DLTIAADNAIFGQTGPKVGSFDGGFGASYLARIVGQKKAREIWFLCRQYDAQQALEMGLV 193 Query: 174 HRVVPAEKLMEEALSLAKELAQGPTRAYALTKKLLLETYRLSLTEALALEAVLQGQAG-- 231 + VVP E+L E + A E+ + A K A A GQAG Sbjct: 194 NCVVPIEQLEAEGIKWAGEILEKSPIAIRCLK--------------AAFNADCDGQAGLQ 239 Query: 232 -----------QTQDHEEGVRAFREKRPPRFQ 252 T++ EG +AF EKRPP F+ Sbjct: 240 ELAGNATLLYYMTEEGAEGKQAFLEKRPPNFR 271 Lambda K H 0.318 0.135 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 277 Length adjustment: 25 Effective length of query: 229 Effective length of database: 252 Effective search space: 57708 Effective search space used: 57708 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory