Align NatD, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_011317349.1 AVA_RS02360 branched-chain amino acid ABC transporter permease
Query= TCDB::Q8YXD0 (288 letters) >NCBI__GCF_000204075.1:WP_011317349.1 Length = 316 Score = 138 bits (347), Expect = 2e-37 Identities = 100/313 (31%), Positives = 169/313 (53%), Gaps = 36/313 (11%) Query: 1 MDIQT-IQLIVNGIAVGSIIALAAVGLTLTYGILRLSNFAHGDFLTLGAYLTFFV--NTF 57 MDI +Q ++NG+++GS+ A+ A+G TL Y IL + N AHG TLGAY T+ + TF Sbjct: 1 MDISVFLQQLLNGLSIGSVYAIFALGYTLVYSILGIINLAHGAIFTLGAYFTYALMGGTF 60 Query: 58 GVN---------IWLSMIVAVV------GTVGVMLLSEKLLWSRMRSIRANSTTLIIISI 102 G N I L VA++ G VGV + E++ + +R +++ ++ S+ Sbjct: 61 GFNGLLANATLPIQLPFAVALIIGSSLAGLVGVAM--ERIAFQPLRKKGSDTLLTVVSSL 118 Query: 103 GLALFLRNGIILIWGGRNQNY------NLPITPALDIFG-----VKVPQNQLLVLALAVL 151 G+A+ + N I + G + + NLP PA + FG + + Q+++ ++V+ Sbjct: 119 GVAVVIVNIIQYLVGAESYTFPANTFGNLP--PAFN-FGTLEKPIPIRSVQVVIFTVSVV 175 Query: 152 SIGALHYLLQNTKIGKAMRAVADDLDLAKVSGIDVEQVIFWTWLIAGTVTSLGGSMY-GL 210 + L Y + TK GKA++A+A+D A + GI+ ++ I T+ I+ + L G++ Sbjct: 176 IVAILTYFINCTKYGKAIQAIAEDATTASLLGINSDRFIVLTFFISSFLAGLAGTLVASS 235 Query: 211 ITAVRPNMGWFLILPLFASVILGGIGNPYGAIAAAFIIGIVQEVSTPFLGSQYKQGVALL 270 ++ P G L A ++LGG+G+ GA+ +IG+V E P S YK VA Sbjct: 236 VSIAGPYFGIGFGLRGLAVIVLGGLGSIPGAVLGGLLIGVV-EALVPSDYSGYKDAVAFG 294 Query: 271 IMILVLLIRPKGL 283 I+ ++LL+RP+GL Sbjct: 295 ILFIMLLVRPQGL 307 Lambda K H 0.328 0.144 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 273 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 316 Length adjustment: 27 Effective length of query: 261 Effective length of database: 289 Effective search space: 75429 Effective search space used: 75429 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory