Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_011317351.1 AVA_RS02375 ABC transporter ATP-binding protein
Query= TCDB::Q55164 (267 letters) >NCBI__GCF_000204075.1:WP_011317351.1 Length = 259 Score = 199 bits (506), Expect = 5e-56 Identities = 107/250 (42%), Positives = 159/250 (63%), Gaps = 1/250 (0%) Query: 18 LLLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQGEVLF 77 +L A+ L++ FGGL AV++ V I GLIGPNGAGKTTLFNL++ I P GE+++ Sbjct: 9 ILEAKSLTRRFGGLIAVNNVSFTVNHYEIFGLIGPNGAGKTTLFNLITALIPPSSGELIY 68 Query: 78 NGDSIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFLPRLINFRRVQ 137 +I QL PH+IA G RTFQ ++ L+ LEN+++A T ++ Sbjct: 69 QNKAIAQLGPHEIASLGIARTFQNIRLFGELSALENVIIARHLHTKSTIFTGVLGLPPAP 128 Query: 138 KEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLDEPAAGV 197 KEE +REKA+ +LE VGL +AQ+ A + G ++ LE+ARAL P+++LLDEPAAG+ Sbjct: 129 KEEARSREKALELLEMVGLSDRAQEKARNFAYGDQRRLEIARALALEPQILLLDEPAAGM 188 Query: 198 NPTLIGQICEHIVN-WNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGTPEQIQSD 256 NP+ Q+ E I +R +T ++IEH++ ++M LC + VL G+ +A G P +++D Sbjct: 189 NPSEKQQLSEFIREIRDRFNLTIILIEHHVPLVMGLCDRIAVLDFGQLIALGEPSVVRND 248 Query: 257 PRVLEAYLGD 266 P V+EAYLG+ Sbjct: 249 PAVIEAYLGN 258 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 2 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 259 Length adjustment: 25 Effective length of query: 242 Effective length of database: 234 Effective search space: 56628 Effective search space used: 56628 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory