Align ATPase (characterized, see rationale)
to candidate WP_011317596.1 AVA_RS03725 amino acid ABC transporter ATP-binding protein
Query= uniprot:Q31RN8 (261 letters) >NCBI__GCF_000204075.1:WP_011317596.1 Length = 246 Score = 348 bits (894), Expect = e-101 Identities = 181/242 (74%), Positives = 204/242 (84%), Gaps = 1/242 (0%) Query: 20 TMIYAEGVEKWYGNQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEI 79 ++I AE V KWYG +F L GVSLTV RGEVVV+MGPSGSGKSTF+RT NALE++Q+G I Sbjct: 6 SIIIAEDVHKWYG-KFHVLQGVSLTVNRGEVVVLMGPSGSGKSTFIRTFNALEAYQKGRI 64 Query: 80 WIEGHRLSHDRRDIATIRQEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEATAR 139 I+G LSHD R+I IR+EVGMVFQQFNLFPHLTVLQN+ LAP+ VRR AQAE A Sbjct: 65 TIDGITLSHDLRNIDAIRREVGMVFQQFNLFPHLTVLQNITLAPIWVRRAKKAQAEELAM 124 Query: 140 QLLERVRIAEQADKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLDV 199 QLLERV I EQA+KYPGQLSGGQQQRVAIARALAMQP+I+LFDEPTSALDPEMVREVLDV Sbjct: 125 QLLERVGILEQANKYPGQLSGGQQQRVAIARALAMQPKIMLFDEPTSALDPEMVREVLDV 184 Query: 200 MRDLASEGMTMLVATHEVGFAREVADRVVLMADGQIVEEAPPDRFFTAPQSDRAKQFLAQ 259 MR LA +GMTM+V THEVGFAREVADRVVLM G +VE A PD FFT PQ +R ++FL+Q Sbjct: 185 MRSLARDGMTMVVVTHEVGFAREVADRVVLMDSGHLVESASPDNFFTKPQEERTRKFLSQ 244 Query: 260 IL 261 IL Sbjct: 245 IL 246 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 246 Length adjustment: 24 Effective length of query: 237 Effective length of database: 222 Effective search space: 52614 Effective search space used: 52614 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory