Align High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_011318451.1 AVA_RS08305 LPS export ABC transporter ATP-binding protein
Query= TCDB::P21629 (255 letters) >NCBI__GCF_000204075.1:WP_011318451.1 Length = 242 Score = 130 bits (326), Expect = 3e-35 Identities = 77/246 (31%), Positives = 134/246 (54%), Gaps = 25/246 (10%) Query: 15 FGGLLAVNGVNLKVEEKQVVSMIGPNGAGKTTVFNCLTGFYQPTGGLIRLDGEEIQGLPG 74 +G + VN VNL V + ++V ++GPNGAGKTT F TG +P G + LD +I GLP Sbjct: 12 YGKRVIVNRVNLSVAQGEIVGLLGPNGAGKTTTFYIATGLEKPNQGRVWLDSLDITGLPM 71 Query: 75 HKIARKGVVRTFQNVRLFKEMTAVENLLVAQHRHLNTNFLAGLFKTPAFRRSEREAMEYA 134 HK AR G+ Q +F++++ +N+L+ F ++ E+A Sbjct: 72 HKRARLGIGYLAQEASVFRQLSVQDNILL------------------VFEQTNVPRWEWA 113 Query: 135 AH---WLEEVNLTEFANRSAGTLAYGQQRRLEIARCMMT---RPRILMLDEPAAGLNPKE 188 L E L + A L+ G++RR E+AR + P+ L LDEP AG++P Sbjct: 114 KRLNTLLREFRLEKVAKSKGIQLSGGERRRTELARALAAGGEGPKFLFLDEPFAGVDPIA 173 Query: 189 TDDLKALIAKLRSEHNVTVLLIEHDMKLVMSISDHIVVINQGAPLADGTPEQIRDNPDVI 248 +++ ++A+LR + + +L+ +H+++ ++I+D ++ +G LA G +++ +NP V Sbjct: 174 VFEIQQIVAQLR-DRGMGILITDHNVRETLAITDRAYILREGQILAYGNADELYNNPLVR 232 Query: 249 KAYLGE 254 + YLG+ Sbjct: 233 QYYLGD 238 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 242 Length adjustment: 24 Effective length of query: 231 Effective length of database: 218 Effective search space: 50358 Effective search space used: 50358 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory