Align 2,4-diketo-3-deoxy-L-rhamnonate hydrolase (EC 3.7.1.-) (characterized)
to candidate WP_011318865.1 AVA_RS10475 FAA hydrolase family protein
Query= reanno::BFirm:BPHYT_RS34210 (282 letters) >NCBI__GCF_000204075.1:WP_011318865.1 Length = 257 Score = 150 bits (379), Expect = 3e-41 Identities = 89/219 (40%), Positives = 122/219 (55%), Gaps = 14/219 (6%) Query: 63 MGPCVGKIGKFICIGLNYADHAAESNLPVPAEPVIFNKWTSAISGPNDDVEIPRGSKKTD 122 + PC K + +G NYADHAAE VP+EP+IF K + I +++ P S++ D Sbjct: 52 LAPCAPS--KIVAVGKNYADHAAEMGTSVPSEPLIFLKPPTTIIASETEIKYPLQSQRVD 109 Query: 123 WEVELGVVIGKPAKYIDEANALDYVAGYCVINDVSEREWQIEKGGTWDKGKGFDTFGPIG 182 +E EL ++IG A + GY + NDV+ R+ Q K G W + KGFDTF P+G Sbjct: 110 YEGELALIIGDRTCNCTPEEAQTKIWGYTIANDVTARDLQ-RKDGQWTRAKGFDTFCPLG 168 Query: 183 PWVVTRDEVADPQNLSLWLEVDGHRYQNGSTKTMVFGVAKLVSYVSQCMSLQPGDVISTG 242 PW+V E++ L +L D + Q+ MVF LVSY+SQ M+L PGDVI TG Sbjct: 169 PWIVR--ELSPGARLQTFLNDDANPVQSAGIDQMVFAPDFLVSYISQVMTLLPGDVILTG 226 Query: 243 TPPGVGMGVKPNPVFLKPGQTIRLGIEGLGEQTQKTYAA 281 TP GVG L+ G IR+ IEG+G + + T AA Sbjct: 227 TPEGVGA--------LQQGDRIRVEIEGIG-RLENTVAA 256 Lambda K H 0.315 0.138 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 257 Length adjustment: 25 Effective length of query: 257 Effective length of database: 232 Effective search space: 59624 Effective search space used: 59624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory