Align Serine hydroxymethyltransferase; SHMT; Serine methylase; EC 2.1.2.1; L-threonine/L-allo-threonine aldolase; EC 4.1.2.48 (uncharacterized)
to candidate WP_011318867.1 AVA_RS10490 serine hydroxymethyltransferase
Query= curated2:D3DKC4 (427 letters) >NCBI__GCF_000204075.1:WP_011318867.1 Length = 427 Score = 490 bits (1262), Expect = e-143 Identities = 242/419 (57%), Positives = 303/419 (72%), Gaps = 1/419 (0%) Query: 4 LFNTDAEIYEAIVKEYERQFYHLELIASENFTSLAVMEAQGSVMTNKYAEGLPHKRYYGG 63 L N+D I I +E +RQ HLELIASENFTS AV+ AQGSV+TNKYAEGLP KRYYGG Sbjct: 9 LTNSDPAIAGLINQELQRQRDHLELIASENFTSAAVLAAQGSVLTNKYAEGLPGKRYYGG 68 Query: 64 CEFVDIAEDLAIERAKALFDAEHANVQPHSGTQANMAVYMAVLKPGDTIMGMDLSHGGHL 123 CEF+D E +AI+RAK LF A HANVQPHSG QAN AV++ +L PGD IMGMDLSHGGHL Sbjct: 69 CEFIDKIEQIAIDRAKQLFGAAHANVQPHSGAQANFAVFLTLLAPGDKIMGMDLSHGGHL 128 Query: 124 THGAKVNFSGKIYNAVYYGVHPETHLIDYDQLYRLAKEHKPKLIVGGASAYPRVIDWAKL 183 THG+ VN SGK + +YGV +T +DYDQ+ LA +PKL++ G SAYPR+ID+ K Sbjct: 129 THGSPVNVSGKWFQVCHYGVSQQTEQLDYDQIRELALRERPKLLICGYSAYPRIIDFEKF 188 Query: 184 REIADSVGAYLMVDMAHYAGLIAGGVYPNPVPYAHFVTSTTHKTLRGPRSGFILC-KKEF 242 R IAD VGAYL+ D+AH AGL+A G++P+P+PY H VT+TTHKTLRGPR G IL E Sbjct: 189 RSIADEVGAYLLADIAHIAGLVASGLHPDPIPYCHVVTTTTHKTLRGPRGGLILTGDAEL 248 Query: 243 AKDIDKSVFPGIQGGPLMHVIAAKAVAFKEAMSQEFKEYARQVVANARVLAEEFIKEGFK 302 K +DKSVFPG QGGPL HVIA KAVAF EA+ EF+ Y+ QV+ NAR LA + G K Sbjct: 249 GKKLDKSVFPGSQGGPLEHVIAGKAVAFGEALKPEFQGYSAQVIENARALANQLQNRGLK 308 Query: 303 VVSGGTDSHIVLLDLRDTGLTGREVEEALGKANITVNKNAVPFDPLPPVKTSGIRLGTPA 362 +VS GTD+H++L+DLR +TG+ ++ + + NIT NKN VPFDP P TSG+RLG+PA Sbjct: 309 LVSDGTDNHLMLVDLRSVNMTGKRADQLVSEVNITANKNTVPFDPQSPFVTSGLRLGSPA 368 Query: 363 MTTRGMKEDQMRIIARLISKVIKNIGDEKVIEYVRQEVIEMCEQFPLYPELREEINHLA 421 MTTRGM E + I +I+ + N + V + ++ V +C++FPLYP L + LA Sbjct: 369 MTTRGMGEAEFTEIGNIIADRLLNPDSDTVAQDCKRRVAALCDRFPLYPHLEIPVPVLA 427 Lambda K H 0.319 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 558 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 427 Length adjustment: 32 Effective length of query: 395 Effective length of database: 395 Effective search space: 156025 Effective search space used: 156025 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory