Align histidine transport ATP-binding protein hisP (characterized)
to candidate WP_011319604.1 AVA_RS14435 ABC transporter ATP-binding protein
Query= CharProtDB::CH_003210 (257 letters) >NCBI__GCF_000204075.1:WP_011319604.1 Length = 252 Score = 141 bits (355), Expect = 1e-38 Identities = 92/218 (42%), Positives = 127/218 (58%), Gaps = 16/218 (7%) Query: 16 GEHEV--LKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEGSIVVNGQTINLVR 73 GE EV L V+L N G+ SI+G SGSGKST + I L++P+EG ++G + + Sbjct: 34 GETEVKALNDVNLVINEGEYCSIMGPSGSGKSTAMNIIGCLDRPTEGHYYLDGLDVAQMN 93 Query: 74 DKDGQLKVADKNQLRLLRTR-LTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKQEARERA 132 DKD L +R R L VFQ F+L ++ LENVM P+ ++ E R+RA Sbjct: 94 DKD----------LAHIRNRKLGFVFQQFHLLPQLSALENVM-LPMVYADVTPNERRDRA 142 Query: 133 VKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPTSALDPELVGEVL 192 + L +VG+++R K P LSGGQQQRV+IARA+ P VLL DEPT ALD EVL Sbjct: 143 TEALIRVGLEKRLNNK-PTQLSGGQQQRVAIARAIVNRPVVLLADEPTGALDSRTTQEVL 201 Query: 193 RIMQQLAEEGKTMVVVTHEMGFARHVSTHVIFLHQGKI 230 I +L G T+V+VTHE AR + +++ G++ Sbjct: 202 DIFTELNSGGITVVMVTHEPEVARQ-TKRIVWFKDGQV 238 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 252 Length adjustment: 24 Effective length of query: 233 Effective length of database: 228 Effective search space: 53124 Effective search space used: 53124 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory