Align Fructokinase-1; Fructokinase I; OsFKI; EC 2.7.1.4 (characterized)
to candidate WP_011319667.1 AVA_RS14780 carbohydrate kinase
Query= SwissProt::Q0JGZ6 (323 letters) >NCBI__GCF_000204075.1:WP_011319667.1 Length = 325 Score = 164 bits (416), Expect = 2e-45 Identities = 107/320 (33%), Positives = 165/320 (51%), Gaps = 8/320 (2%) Query: 8 VVSFGEMLIDFVPTVAGVSLAEAPAFVKAPGGAPANVAIAVARLGGGAAFVGKLGDDEFG 67 V+ GE+L D + G+ L E ++ PGGAPANVA A+ +LG A F+G +G+DE G Sbjct: 6 VLCLGEVLFDCLADQLGLKLEEVKSWTAYPGGAPANVACALVKLGTPAGFIGAVGEDEPG 65 Query: 68 RMLAAILRDNGVDDGGVVFDAGARTALAFVTLRADGEREF----MFYRNPSADMLLTHAE 123 L +L++ GVD GV + A T +V G+R F + + AD L + Sbjct: 66 NALVKLLQEVGVDTTGVQRHSTAPTRQVYVVRDLAGDRTFAGFGQYDTSEFADTHLQAKQ 125 Query: 124 LNVELIKRAAVFHYGSISLIAEPCRSAHLRAMEIAKEAGALLSYDPNLREALWPSREEAR 183 L + + A G++ L A RA+E+A++ + D N R W AR Sbjct: 126 LPESVFQEADFLILGTLELAYPDSEKAIHRALELAEQYDLKIVLDVNWRPVFWHDENIAR 185 Query: 184 TKILSIWDQADIVKVSEVELEFLTGIDSVEDDVVMKLWRPTMKLLLVTLGDQGCKYYARD 243 KI I+ + D +K+++ E E+L D + +++ +LVT G+ GC Y + Sbjct: 186 QKIQEIFKRVDFLKLAKEEAEWLF---DTSDPGAITYRLGSIEGVLVTDGENGCGYCLGE 242 Query: 244 FRGAVPSYKVQQVDTTGAGDAFVGALLRRIVQDP-SSLQDQKKLEEAIKFANACGAITAT 302 G +P++ V VDTTGAGD+F+ + ++ Q +L D + + I +A+A GA+T T Sbjct: 243 NEGKIPAFAVSVVDTTGAGDSFLAGFIHQLSQHGIHNLNDAETAKRIITYASAVGALTTT 302 Query: 303 KKGAIPSLPTEVEVLKLMES 322 K GAI S PT VEV + S Sbjct: 303 KAGAIASQPTAVEVETFLAS 322 Lambda K H 0.320 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 254 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 325 Length adjustment: 28 Effective length of query: 295 Effective length of database: 297 Effective search space: 87615 Effective search space used: 87615 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory