Align Malonate-semialdehyde dehydrogenase 1; MSA dehydrogenase 1; EC 1.2.1.-; Methylmalonate-semialdehyde dehydrogenase 1; MMSA dehydrogenase 1; MSDH 1; EC 1.2.1.27 (uncharacterized)
to candidate WP_011319687.1 AVA_RS14900 L-glutamate gamma-semialdehyde dehydrogenase
Query= curated2:Q5L025 (488 letters) >NCBI__GCF_000204075.1:WP_011319687.1 Length = 993 Score = 249 bits (636), Expect = 3e-70 Identities = 169/479 (35%), Positives = 253/479 (52%), Gaps = 19/479 (3%) Query: 15 IGGQWVASSGTETLEVPNPAT-GEVLARVPISTKEDVDQAVQAAKKAFATWKDVPVPKRA 73 I G++V ++ E ++ NP+ GEV+ +V + + E +QA+QAAK AF W+ PV +RA Sbjct: 509 INGEYVQTA--EVIDSVNPSNFGEVIGKVGLISVEQAEQAMQAAKAAFPGWRRTPVKERA 566 Query: 74 RIMFSFHHLLNQHHEELAELVVQENGKAYKEAYGEIQRGIECVEFAAGAPTLLMGESLSN 133 I+ LL + EL+ +V E GK KEA E+ I+ + A L + Sbjct: 567 AILRRAGDLLEERRAELSAWIVLEVGKPVKEADAEVSEAIDFCRYYADEMERLYQGINYD 626 Query: 134 IAEEIDSEMFRYPLGVVAGITPFNFPMMVPLWMFPLAIVCGNTFVLKPSERTPILANKLA 193 +A E + +++ P G+V I+P+NFP+ + M A+V GN +LKP+E + ++ KL Sbjct: 627 VAGETNRYIYQ-PRGIVVVISPWNFPLAIACGMTVAALVTGNCTLLKPAETSSVITAKLT 685 Query: 194 ELFTEAGAPPGVLNVVHGAHEVVNA-LIDHEDIRAISFVGSQPVAKYVYERTAA------ 246 E+ EAG P GV V G V A L+ H D I+F GSQ V +Y A Sbjct: 686 EILLEAGIPKGVFQYVPGKGSQVGAYLVSHPDTHLIAFTGSQEVGCRIYAEAATLKPQQR 745 Query: 247 QGKRVQALSGAKNHHIVMPDADVETAVQHVISSAFGSAGQRCMACSAVVIV-GENETFVR 305 KRV A G KN IV AD++ AV V+ SAFG +GQ+C ACS V++V + F+ Sbjct: 746 HMKRVIAEMGGKNAIIVDESADLDQAVIGVVQSAFGYSGQKCSACSRVIVVEAIYDAFIH 805 Query: 306 RLKQKADELIIGNGMDPEVLLTPVIRQSHREKVLGYIQKGIEEGAVLLRDGRKEMDDRPE 365 RL + L IG P + PVI + R+++ YI+KG E V L E+ Sbjct: 806 RLVEATKSLNIGEAELPSTQVGPVIDANARDRIREYIEKGKAESQVAL-----ELSAPNH 860 Query: 366 GNFLGPTIFDYVTPDMTIAKEEIFAPVLSLLRANDLDEALSYIRKSRYGNGATIYTKDAK 425 G F+GP IF V P TIA++EIF PVL++++A D +AL+ + Y +Y++ Sbjct: 861 GYFVGPVIFGEVPPHGTIAQQEIFGPVLAVIKAKDFAQALAIANDTDYALTGGLYSRTPS 920 Query: 426 AVRKFREEADAGMLGINVGVP-ATMAFFPFSGWKDSFYGDLHVNGKDGVNFYTRKKMIT 483 +++ +EE + G L IN + A +A PF G+K S G G D + + + IT Sbjct: 921 HIQQAQEEFEVGNLYINRNITGAIVARQPFGGFKLSGVGS-KAGGPDYLLQFLEPRTIT 978 Lambda K H 0.319 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 942 Number of extensions: 51 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 488 Length of database: 993 Length adjustment: 39 Effective length of query: 449 Effective length of database: 954 Effective search space: 428346 Effective search space used: 428346 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 54 (25.4 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory