Align ABC transporter for L-Asparagine and possibly other L-amino acids, putative ATPase component (characterized)
to candidate WP_011320300.1 AVA_RS18175 ATP-binding cassette domain-containing protein
Query= reanno::pseudo13_GW456_L13:PfGW456L13_4773 (244 letters) >NCBI__GCF_000204075.1:WP_011320300.1 Length = 244 Score = 144 bits (362), Expect = 2e-39 Identities = 84/223 (37%), Positives = 135/223 (60%), Gaps = 7/223 (3%) Query: 1 MISIKSINKWYGDF----QVLTDCSTEVKKGEVIVVCGPSGSGKSTLIKCVNALEPFQKG 56 +I+IKS+N +YG Q+L D + E+ GE++++ GPSGSGK+TL+ + L Q+G Sbjct: 6 VIAIKSLNHYYGKGALKRQILFDINLEIYPGEIVIMTGPSGSGKTTLLSLIGGLRSVQEG 65 Query: 57 DIVVDGTSIADPKTN-LPKLRSRVGMVFQHFELFPHLTITENLTIAQIKVLGRSKEEATK 115 ++ G ++ N L ++R +G +FQ L LT +N+ +A S+EEA Sbjct: 66 NLQFLGVELSGASQNKLVQIRRSIGYIFQAHNLLGFLTARQNVQMAVELNEHISQEEAIA 125 Query: 116 KGLQLLERVGLSAHAHKHPGQLSGGQQQRVAIARALAMDPIVMLFDEPTSALDPEMVNEV 175 K +L+ VGL +P LSGGQ+QRVAIARAL +P ++L DEPT+ALD + +V Sbjct: 126 KAEAMLKAVGLENRVDYYPDNLSGGQKQRVAIARALVNNPPLVLADEPTAALDKQSGRDV 185 Query: 176 LDVMVQLA-HEGMTMMCVTHEMGFARKVADRVIFMDQGKIIED 217 +++M +LA +G +++ VTH+ +ADR++ M+ G + D Sbjct: 186 VEIMQRLAKDQGTSILLVTHDNRIL-DIADRIVEMEDGILARD 227 Lambda K H 0.321 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 130 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 244 Length adjustment: 24 Effective length of query: 220 Effective length of database: 220 Effective search space: 48400 Effective search space used: 48400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory