Align BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)
to candidate WP_011320300.1 AVA_RS18175 ATP-binding cassette domain-containing protein
Query= TCDB::P73721 (252 letters) >NCBI__GCF_000204075.1:WP_011320300.1 Length = 244 Score = 145 bits (365), Expect = 1e-39 Identities = 86/212 (40%), Positives = 127/212 (59%), Gaps = 6/212 (2%) Query: 19 GAL--QVLRGVTGEIYPKDVISIIGPSGCGKSTFLRCLNRLEPISGGRLEVAGVDLSGAK 76 GAL Q+L + EIYP +++ + GPSG GK+T L + L + G L+ GV+LSGA Sbjct: 19 GALKRQILFDINLEIYPGEIVIMTGPSGSGKTTLLSLIGGLRSVQEGNLQFLGVELSGAS 78 Query: 77 IDQKHLRQLRVRVGMVFQHFNLFPHLTVLQNLLLAPRKVLRIPMAEAKDRALTYLDKVGL 136 Q L Q+R +G +FQ NL LT QN+ +A I EA +A L VGL Sbjct: 79 --QNKLVQIRRSIGYIFQAHNLLGFLTARQNVQMAVELNEHISQEEAIAKAEAMLKAVGL 136 Query: 137 GTKADNYPDQLSGGQKQRVAIARGLCMKPEILLFDEPTSALDPELVGEVLNVMKQLA-EE 195 + D YPD LSGGQKQRVAIAR L P ++L DEPT+ALD + +V+ +M++LA ++ Sbjct: 137 ENRVDYYPDNLSGGQKQRVAIARALVNNPPLVLADEPTAALDKQSGRDVVEIMQRLAKDQ 196 Query: 196 GMTMAVVTHEMQFAREVSNRVFFFNQGIIEEE 227 G ++ +VTH+ + ++++R+ GI+ + Sbjct: 197 GTSILLVTHDNRIL-DIADRIVEMEDGILARD 227 Lambda K H 0.321 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 138 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 244 Length adjustment: 24 Effective length of query: 228 Effective length of database: 220 Effective search space: 50160 Effective search space used: 50160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory