Align Polyphosphate glucokinase; EC 2.7.1.63; ATP-dependent glucokinase; EC 2.7.1.2; Polyphosphate--glucose phosphotransferase (uncharacterized)
to candidate WP_011320705.1 AVA_RS20345 ROK family protein
Query= curated2:Q49988 (324 letters) >NCBI__GCF_000204075.1:WP_011320705.1 Length = 239 Score = 119 bits (298), Expect = 7e-32 Identities = 76/233 (32%), Positives = 121/233 (51%), Gaps = 11/233 (4%) Query: 78 RGFGIDIGGSSIKGGIVDLDIGQLIGDRIKLLTPQPATPLAVAKTIAEVVNAFGWTAPLG 137 R +DIGGS +K ++D+ G + +R ++ TPQPATP V I + A G + Sbjct: 9 RTLSVDIGGSGVKALVLDIT-GNPVTERARVDTPQPATPEVVINAIMVLAAAQGEFHRVS 67 Query: 138 VTYPGVVTQGVVRTAANVDDSWIGTNARDIISAELNSQEVTILNDADAAGLAEGRYGAGK 197 V +PGVV GV TA N+D WIG + +S L+ + V ++NDAD G +GA K Sbjct: 68 VGFPGVVRAGVTETAVNLDSDWIGFDLEAALSQRLH-KPVRVINDADMQG-----FGAIK 121 Query: 198 NNSGLIVLLTFGTGIGSAVIHNGKLIPNTEFGHLEV-DGKEAEQRAASSVKDKYKWSYRT 256 G+ +++T GTG GSA+ +GKL+PN E GH G+ E++ + DK + Sbjct: 122 GR-GVELVITLGTGFGSALFVDGKLVPNMEMGHHPFRKGETYEEQLGRATLDKI--GQKK 178 Query: 257 WAKQVTRVLVAIENAMCPDLFIAGGGISRKADRWIPLLENRTPMVAAALQNTA 309 W +++ + + +++ D GGG + + + +PL P + L A Sbjct: 179 WNRRLEKAIASLQRLFNYDYLYIGGGEAVRVNFQLPLNVKLIPNITGLLGGIA 231 Lambda K H 0.316 0.131 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 239 Length adjustment: 25 Effective length of query: 299 Effective length of database: 214 Effective search space: 63986 Effective search space used: 63986 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory