Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_011338188.1 RSPH17029_RS10165 amino acid ABC transporter ATP-binding protein
Query= TCDB::Q52666 (263 letters) >NCBI__GCF_000015985.1:WP_011338188.1 Length = 265 Score = 221 bits (564), Expect = 9e-63 Identities = 114/246 (46%), Positives = 162/246 (65%), Gaps = 10/246 (4%) Query: 23 IQISQMNKWYGQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQSGKIIVD 82 I+I ++K YG VL+ +++ +G + + G SGSGKST++RC N LE+ Q G+I+ + Sbjct: 17 IEIRNLHKSYGNLEVLKGVDMVAPKGHVVSLIGSSGSGKSTLLRCANLLEDSQDGEILFE 76 Query: 83 GIELT----------SDLKNIDKVRSEVGMVFQHFNLFPHLTILENLTLAPIWVRKVPKR 132 G + +D + ++R+ + MVFQ FNL+ H+TIL+N+ AP+ V P+ Sbjct: 77 GEAVRWRGEGLARHPADKAQVIRIRTNLSMVFQQFNLWSHMTILQNVMEAPVTVLGRPRA 136 Query: 133 EAEETAMYYLEKVKIPEQAQKYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPTSALDPEM 192 E EE A YL KV I ++ YP QLSGGQQQR AIAR+LCM+P+ +LFDEPTSALDPE+ Sbjct: 137 EVEEAARRYLAKVGIGDKCDAYPAQLSGGQQQRAAIARALCMEPRALLFDEPTSALDPEL 196 Query: 193 IKEVLDTMIQLAEEGMTMLCVTHEMGFAQAVANRVIFMADGQIVEQNNPHDFFHNPQSER 252 +EV+ + LAEEG TML VTH+M A V++ VIF+ G+I E+ P F PQ++R Sbjct: 197 EQEVVRVIKALAEEGRTMLLVTHDMRMAADVSDHVIFLHQGRIEEEGPPDRLFGAPQTDR 256 Query: 253 TKQFLS 258 +QFLS Sbjct: 257 LRQFLS 262 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 174 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 265 Length adjustment: 25 Effective length of query: 238 Effective length of database: 240 Effective search space: 57120 Effective search space used: 57120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory