Align Lactaldehyde reductase (characterized, see rationale)
to candidate WP_011365768.1 GMET_RS05275 alcohol dehydrogenase
Query= uniprot:Q8A199 (384 letters) >NCBI__GCF_000012925.1:WP_011365768.1 Length = 382 Score = 253 bits (647), Expect = 5e-72 Identities = 145/372 (38%), Positives = 210/372 (56%), Gaps = 3/372 (0%) Query: 12 FGAGCRSVIAVEAARRGFKKAFFVTDKDLIKFGVAAEIIKVFDDNHIPYELYSDVKANPT 71 FG G S I AAR G K F V+D+D+I G + + + E+YS + +NP Sbjct: 13 FGQGSLSQIGESAARIGASKVFLVSDEDVISAGWVDKALHYLHAVGLETEIYSSLTSNPK 72 Query: 72 IANVQNGVAAYKASGADFIVALGGGSSIDTAKGIGIVVNNPDFADVKSLEGVADTKHKAV 131 V G Y ASG D IVA+GGGS D AK + I+ +N +++ EG+ Sbjct: 73 DFEVLEGARHYVASGCDAIVAVGGGSPTDVAKAVAILASNG--GELRDYEGINRISRPLP 130 Query: 132 PTFALPTTAGTAAEVTINYVIIDEDARKKMVCVDPNDIPAVAIVDPELMYSMPKGLTAAT 191 P P+TAG +EV+ +I+D + + KM + + +P +AIVDPEL+ + L AAT Sbjct: 131 PMVIAPSTAGAGSEVSPFAIIVDTERKLKMSIISKSLVPDIAIVDPELLRTKDAKLAAAT 190 Query: 192 GMDALTHAIESYITPGAWAMSDMFELKAIEMIAQNLKAAVDNGKDTVAREAMSQAQYIAG 251 GMDALTH IESY++ A ++D+ KAI++IA NL+ AV + D A M+ A AG Sbjct: 191 GMDALTHGIESYVSLAATPLTDIHACKAIQLIAANLRRAVADRGDMEANTNMAMASLTAG 250 Query: 252 MGFSNVGLGIVHSMAHPLGAFYDTPHGVANALLLPYVMEYNAESPAAPKYIHIAKAMGVN 311 + FSN LG H+M H + D HG ANA +LP+VME+N S ++ HIA ++G + Sbjct: 251 IAFSNAILGATHAMTHQVDGLLDQHHGEANASILPHVMEFNL-SACPERFKHIAWSLGKD 309 Query: 312 TDGMTETEGVKAAIEAVKALSLSIGIPQKLHEINVKEEDIPALAVAAFNDVCTGGNPRPT 371 + EG + AIE ++ L IG+ + L + ++EE IP L+ A ND C NPR Sbjct: 310 VRNTGQEEGARLAIEGIRELIADIGLAKGLGAMGLREEFIPLLSRNALNDACLVTNPRNA 369 Query: 372 SVAEIEVLYRKA 383 +V +IE ++RKA Sbjct: 370 TVDDIEAIFRKA 381 Lambda K H 0.317 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 365 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 382 Length adjustment: 30 Effective length of query: 354 Effective length of database: 352 Effective search space: 124608 Effective search space used: 124608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory