Align ornithine δ-aminotransferase (EC 2.6.1.13) (characterized)
to candidate WP_011372739.1 SUDEN_RS05820 glutamate-1-semialdehyde 2,1-aminomutase
Query= metacyc::MONOMER-16810 (468 letters) >NCBI__GCF_000012965.1:WP_011372739.1 Length = 430 Score = 111 bits (278), Expect = 4e-29 Identities = 88/292 (30%), Positives = 142/292 (48%), Gaps = 24/292 (8%) Query: 54 PMVFSKAKDVHVWDPEGRKYLDFLSAYSAVNQGHCHEKILNALSQQAQQLTLSSRAFHND 113 P+ + ++ D +G +Y+DF+ ++ + GH E I +A+ + + LS A Sbjct: 35 PLFIANGSGAYLTDIDGNRYVDFVQSWGPLLFGHRDESIESAVIEAVKH-GLSFGAPTQA 93 Query: 114 IFPIFAQHLTSMFGYEMILPMNTGAEGVETALKLARKWGYEKKHIPKNEAIIISCCGCFH 173 + A ++ E I +++G E V +A++LAR GY N I+ GC+H Sbjct: 94 ESDLAALVISMFDSIEKIRFVSSGTEAVMSAIRLAR--GYT------NCDDIVKFTGCYH 145 Query: 174 GRTTAVISMSCDNEATRGFGPFLPGL--------LKVDFGDADSLKSMFEAHGDKVAGFL 225 G + +++ + AT G P PG+ L ++ + +S+K F D VA + Sbjct: 146 GHSDSLLVQAGSGAATFG-NPSSPGVPADFTKHTLLAEYNNIESVKKCFSDSKD-VACVI 203 Query: 226 FEPIQGEAGVIVPPKGYLQSVRELCSKYNVLMIADEIQTGIGRTGKLLACEWESVRPDVV 285 EPI G G++ K +L+ +RELC L+I DE+ +G R A V+PD+V Sbjct: 204 IEPIAGNMGLVPADKEFLRELRELCDANGALLIFDEVMSGF-RASVHGAESITGVKPDIV 262 Query: 286 ILGKALGGGVLPVSAVLADKDIMLCFKPG---EHGSTFGGNPLASAVAIAAL 334 LGK +GGG +PV A A +IM P T GNP+A A +AA+ Sbjct: 263 TLGKVIGGG-MPVGAFGARAEIMAKLSPEGPVYQAGTLSGNPVAMAAGLAAI 313 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 476 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 468 Length of database: 430 Length adjustment: 33 Effective length of query: 435 Effective length of database: 397 Effective search space: 172695 Effective search space used: 172695 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory