Align 2-keto-isovalerate dehydrogenase component β subunit (EC 1.2.4.4) (characterized)
to candidate WP_011425656.1 RHE_RS12245 transketolase
Query= metacyc::MONOMER-11684 (327 letters) >NCBI__GCF_000092045.1:WP_011425656.1 Length = 318 Score = 94.7 bits (234), Expect = 3e-24 Identities = 88/296 (29%), Positives = 135/296 (45%), Gaps = 25/296 (8%) Query: 19 ERDSRVFVLGEDVGR-KGGVFKATAGLYEQFGEERVMDTPLAESAIAGVGIGAAMYGMRP 77 E + V V + VG K G FKA G ER+++ +AE + GVG G A G P Sbjct: 27 ENEMIVAVCNDSVGSSKLGGFKAKFG-------ERLVNVGIAEQNMVGVGAGLANGGRLP 79 Query: 78 IAEMQFADFIMPAVNQIISEAAKIRYRSNNDWSCPIVVRAPYGGGVHGALYHSQSVEAIF 137 ++ QI A I Y + N I YG G +HS A Sbjct: 80 FVCGAAPFLTGRSLEQI---KADISYSNANVKLVGISSGMAYGE--LGPTHHSIEDFAWT 134 Query: 138 ANQPGLKIVMPSTPYDAKGLLKAAVRDEDPVLFFEHKRAYRLIKGEVPADDYVLPIGKAD 197 P L ++ P + + A P R R+ ++ + + +GKA+ Sbjct: 135 RVLPNLPVIAPCDRIETAAAVAWAATYSGPCFL----RLSRVGVPDLLPEGHRFELGKAN 190 Query: 198 VKREGDDITVITYGLCVHFALQAAERLEKDGISAHVVDLRTVYPLDKEAIIEAASKTGKV 257 + R+G D+T+I G H ++AAE L + GI A V++L TV P+D+EAII AA +TG + Sbjct: 191 LLRQGSDVTLIANGTLTHRIVKAAEILAERGIDARVLNLATVRPIDEEAIIAAARETGAI 250 Query: 258 LLVTEDTKEGSIMSEVAAIISEHCLFDLDAPIKRLAGPDIPAMPYAPTMEKYFMVN 313 + E + G + S VA ++ ++ P+KRL P + YAPT F+++ Sbjct: 251 VTAEEHSIFGGLGSAVAEVVVDNA----PVPMKRLGVPGV----YAPTGSAEFLLD 298 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 218 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 327 Length of database: 318 Length adjustment: 28 Effective length of query: 299 Effective length of database: 290 Effective search space: 86710 Effective search space used: 86710 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory