Align β-glycosidase (β-gly) (EC 3.2.1.21|3.2.1.23) (characterized)
to candidate WP_011426853.1 RHE_RS18615 beta-glucosidase
Query= CAZy::ABI35984.1 (431 letters) >NCBI__GCF_000092045.1:WP_011426853.1 Length = 457 Score = 385 bits (989), Expect = e-111 Identities = 206/432 (47%), Positives = 267/432 (61%), Gaps = 17/432 (3%) Query: 8 FLWGVATSAYQIEGATQEDGRGPSIWDAFARRPGAIRDGSTGEPACDHYRRYEEDIALMQ 67 F +GVAT+A+QIEGA++ DGR PSIWDAF PG + + G+ ACDHY R E+D+ L++ Sbjct: 15 FTFGVATAAFQIEGASKADGRKPSIWDAFCNMPGRVHNRDNGDVACDHYNRLEQDLDLVK 74 Query: 68 SLGVRAYRFSVAWPRILPEGRGRINPKGLAFYDRLVDRLLASGITPFLTLYHWDLPLALE 127 +GV AYRFS+AWPRI+P+G G +N GL FYDRLVD A GI F TLYHWDLPL L Sbjct: 75 EMGVEAYRFSIAWPRIIPDGTGPVNEAGLDFYDRLVDGCKARGIKTFATLYHWDLPLLLA 134 Query: 128 ERGGWRSRETAFAFAEYAEAVARALADRVPFFATLNEPWCSAFLGHWTGEHAPGLRNLEA 187 GGW +R TA+AF YA+ V L DR+ AT NEPWC +L H G HAPG RN++A Sbjct: 135 GDGGWTARSTAYAFQRYAKTVMSRLGDRLDAVATFNEPWCIVWLSHLYGIHAPGERNMQA 194 Query: 188 ALRAAHHLLLGHGLAVEALRAAGAR-RVGIVLNFAPAYGE-----DPEAVDVADRYHNRY 241 AL A H++ L HGL VEA+R+ VG+VLN A D A + A ++HN Sbjct: 195 ALHAMHYMNLAHGLGVEAIRSEAPNVPVGLVLNAASIIASSTSPADLAAAERAHQFHNGA 254 Query: 242 FLDPILGKGYPES---PFRDPPPVPILSRDLELVARPLDFLGVNYYAPVRV---APGTGT 295 F DP+ YP++ D PV I DL+++++ LD+ G+NYY P RV A G Sbjct: 255 FFDPVFKGEYPKAFVQALGDRMPV-IEDGDLKVISQKLDWWGLNYYTPERVTDDADRKGD 313 Query: 296 LP--VRYLPPEGPATAMGWEVYPEGLHHLLKRLGREVPWP-LYVTENGAAYPDLWTGEAV 352 P V+ P T +GWE+Y GL L++ L R P Y+TENGA + + Sbjct: 314 FPWTVKAPPASEVKTDIGWEIYAPGLKLLVEDLYRRYELPDCYITENGAC-DNTGVADGE 372 Query: 353 VEDPERVAYLEAHVEAALRAREEGVDLRGYFVWSLMDNFEWAFGYTRRFGLYYVDFPSQR 412 V+D R+ YL H++ ++G LRGYF WSLMDNFEWA GY RFGL +VD+ +QR Sbjct: 373 VDDTMRLDYLGDHLDVLADLIKDGYPLRGYFAWSLMDNFEWAEGYRMRFGLVHVDYETQR 432 Query: 413 RIPKRSALWYRE 424 R K+S WYR+ Sbjct: 433 RTVKKSGKWYRD 444 Lambda K H 0.322 0.140 0.453 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 641 Number of extensions: 39 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 431 Length of database: 457 Length adjustment: 32 Effective length of query: 399 Effective length of database: 425 Effective search space: 169575 Effective search space used: 169575 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory