Align 2-methylbutanoyl-CoA dehydrogenase (EC 1.3.8.5) (characterized)
to candidate WP_011444883.1 SARO_RS06120 acyl-CoA dehydrogenase
Query= reanno::pseudo5_N2C3_1:AO356_26355 (375 letters) >NCBI__GCF_000013325.1:WP_011444883.1 Length = 394 Score = 249 bits (637), Expect = 7e-71 Identities = 138/371 (37%), Positives = 220/371 (59%), Gaps = 6/371 (1%) Query: 9 QIRDMARQFAQERLKPFAAEWDREHRFPREAIAEMAELGFFGMLVPEQWGGCDTGYLAYA 68 Q + R++ +ERL P E + R P + +AEM E+G FG+ +PE++GG Y Sbjct: 15 QFIEQLRRYVRERLIPAEDEVIAQDRIPDDILAEMREMGLFGITIPEEFGGAGMNISQYI 74 Query: 69 MTLEEIAAGDGACSTIMSVHNSVGCVPILKFGNDEQKAKFLTPLASGAMLGAFALTEPQA 128 T+++++ A + +S++ + I FG EQKA++L +ASG + F LTEP + Sbjct: 75 ETVKQLSYASPAFRSTISINIGMTGSAIKNFGTPEQKAEWLPRIASGE-IACFGLTEPGS 133 Query: 129 GSDASSLKTRARLEGDHYVLNGCKQFITSGQNAGVVIVFAVTDPSAGKRG--ISAFIVPT 186 GSD+++++T A +G+ Y LNG K++IT+ +A + ++ A T A R +SAFIV Sbjct: 134 GSDSAAMQTMAVRDGNGYRLNGTKRYITNSPSAKIGLIMARTSKEALPRNAHVSAFIVDM 193 Query: 187 DSPGYSVARVEDKLGQHASDTCQILFEEVKVPVGNRL--GEEGEGYKIALANLEGGRVGI 244 +PG S+ + + K+GQ + ++ E+V VP G+ L GEEG G++IA+ +L+ GR+ + Sbjct: 194 TAPGISIGKPDKKMGQSGAQIADVIMEDVHVP-GSALVGGEEGRGFQIAMQSLDNGRLSV 252 Query: 245 AAQAVGMARAAFEAARDYARERSSFGKPIIEHQAVAFRLADMATQIAVARQMVHYAAALR 304 A VGM R A + A YA ER +FG+ I Q + LAD ++ A M+ A A Sbjct: 253 AGMGVGMGRRALDTAIRYATERKAFGEAIANFQLIQAMLADSEAELYAAECMIADACARA 312 Query: 305 DSGQPALVEASMAKLFASEMAEKVCSMALQTLGGYGYLNDFPLERIYRDVRVCQIYEGTS 364 D G+ +A+ AKLF+SE +V +Q GG GYL ++P ER +RD R+ +IYEGTS Sbjct: 313 DRGESVQRKAAAAKLFSSEACGRVVDRCVQVYGGAGYLAEYPAERFFRDARILRIYEGTS 372 Query: 365 DIQRMVISRNL 375 I ++ I+++L Sbjct: 373 QIMQLQIAKHL 383 Lambda K H 0.320 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 331 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 394 Length adjustment: 30 Effective length of query: 345 Effective length of database: 364 Effective search space: 125580 Effective search space used: 125580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory