Align Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 (characterized)
to candidate WP_011446105.1 SARO_RS12395 fumarylacetoacetase
Query= SwissProt::P16930 (419 letters) >NCBI__GCF_000013325.1:WP_011446105.1 Length = 431 Score = 350 bits (897), Expect = e-101 Identities = 199/427 (46%), Positives = 254/427 (59%), Gaps = 25/427 (5%) Query: 2 SFIPVA-EDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFTGPVLSKHQD 60 S++P A +DFP+ NLP+GVF+ G+ RPRIG AIGD +LDL + L VL Sbjct: 16 SWVPSALGHADFPVQNLPFGVFAPAGE-RPRIGTAIGDCVLDLCAVGALLPPEVLP---- 70 Query: 61 VFNQPTLNSFMGLGQAAWKEARVFLQNLLSVSQARLRDDTELRKCAFISQASATMHLPAT 120 + P LN+ M + R L LLS R + L A + M LP Sbjct: 71 LLELPELNALMAAPRVVKTALRHRLSELLSDDAHRPMVEPALHDAACVE-----MLLPMR 125 Query: 121 IGDYTDFYSSRQHATNVGIMFRDKENALMPNWLHLPVGYHGRASSVVVSGTPIRRPMGQM 180 IGDYTDFY HATN+G +FR +N L+PN+ H+P+GYHGRASS+ SG P+ RP GQ Sbjct: 126 IGDYTDFYVGIHHATNIGKLFRP-DNPLLPNYKHVPIGYHGRASSIRQSGVPVARPRGQR 184 Query: 181 KPDDSKPPVYGACKLLDMELEMAFFVGPGNRLGEPIPISKAHEHIFGMVLMNDWSARDIQ 240 + +D+ PV+G C LD ELE+ ++ GN LG IPI++A EHI G+ L+NDWSARDIQ Sbjct: 185 RANDADVPVFGPCTRLDYELELGVWISEGNALGTTIPIAEAGEHIAGLCLLNDWSARDIQ 244 Query: 241 KWEYVPLGPFLGKSFGTTVSPWVVPMDALMPFAV---PNPKQDPRPLPYLCHDE----PY 293 WEY PLGPFL K+F TT+SPWVV +AL PF + P P DP PLPYL DE Sbjct: 245 AWEYQPLGPFLAKNFHTTISPWVVTAEALAPFRIAQPPRPLGDPDPLPYL-RDEADRMAG 303 Query: 294 TFDINLSVNLKGE----GMSQAATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASG 349 F I LSV L E G + + MYWT+ Q +THH+ NGC L GDLL +G Sbjct: 304 AFAIELSVWLTSEQMRAGRYPPLRLSRGPASNMYWTIAQMVTHHASNGCGLNSGDLLGTG 363 Query: 350 TISGPEPENFGSMLELSWKGTKPIDLGNGQTRKFLLDGDEVIITGYCQGDGYR-IGFGQC 408 TISG E + GS++E+S G P++L G+TR FLLDGDE+ + G IGFG+C Sbjct: 364 TISGTEQGSKGSLIEISEGGRVPVELPTGETRTFLLDGDEISFSATATAPGRAPIGFGEC 423 Query: 409 AGKVLPA 415 + PA Sbjct: 424 RAVIRPA 430 Lambda K H 0.321 0.139 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 630 Number of extensions: 45 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 419 Length of database: 431 Length adjustment: 32 Effective length of query: 387 Effective length of database: 399 Effective search space: 154413 Effective search space used: 154413 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_011446105.1 SARO_RS12395 (fumarylacetoacetase)
to HMM TIGR01266 (fahA: fumarylacetoacetase (EC 3.7.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01266.hmm # target sequence database: /tmp/gapView.30197.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01266 [M=420] Accession: TIGR01266 Description: fum_ac_acetase: fumarylacetoacetase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-162 524.8 0.0 8.7e-162 524.7 0.0 1.0 1 lcl|NCBI__GCF_000013325.1:WP_011446105.1 SARO_RS12395 fumarylacetoacetase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000013325.1:WP_011446105.1 SARO_RS12395 fumarylacetoacetase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 524.7 0.0 8.7e-162 8.7e-162 1 419 [. 16 430 .. 16 431 .] 0.95 Alignments for each domain: == domain 1 score: 524.7 bits; conditional E-value: 8.7e-162 TIGR01266 1 sfvavak.nsdfplqnlPyGvfstkadssrrigvaiGdqildlskiaaaglfeglalkehqevfkestl 68 s+v++a ++dfp+qnlP+Gvf+ a+ ++rig aiGd +ldl ++ a l+ e + ++ l lcl|NCBI__GCF_000013325.1:WP_011446105.1 16 SWVPSALgHADFPVQNLPFGVFA-PAGERPRIGTAIGDCVLDLCAVGA--LLPP----EVLPLLELPEL 77 89999988**************9.8999***************99988..4444....4556777789* PP TIGR01266 69 naflalgrparkevrerlqkllsesaevlrdnaalrkeallaqaeatmhlPaqiGdytdfyssirhatn 137 na++a +r +++++r+rl +lls++a++ + + al+ +a ++m lP++iGdytdfy++i+hatn lcl|NCBI__GCF_000013325.1:WP_011446105.1 78 NALMAAPRVVKTALRHRLSELLSDDAHR-----PMVEPALHDAACVEMLLPMRIGDYTDFYVGIHHATN 141 ***********************66655.....677889****************************** PP TIGR01266 138 vGilfrgkdnallPnykhlPvgyhGrassvvvsGtelrrPvGqikadnakePvfgpckkldlelelaff 206 +G+lfr +dn+llPnykh+P+gyhGrass++ sG ++ rP Gq +a++a++Pvfgpc +ld+elel+++ lcl|NCBI__GCF_000013325.1:WP_011446105.1 142 IGKLFR-PDNPLLPNYKHVPIGYHGRASSIRQSGVPVARPRGQRRANDADVPVFGPCTRLDYELELGVW 209 ******.************************************************************** PP TIGR01266 207 vgtenelGeavpiekaeehifGvvllndwsardiqaweyvPlGPflaksfattvsPwvvsiealePfrv 275 ++++n+lG+++pi a ehi+G++llndwsardiqawey+PlGPflak+f tt+sPwvv++eal Pfr+ lcl|NCBI__GCF_000013325.1:WP_011446105.1 210 ISEGNALGTTIPIAEAGEHIAGLCLLNDWSARDIQAWEYQPLGPFLAKNFHTTISPWVVTAEALAPFRI 278 ********************************************************************* PP TIGR01266 276 aq.lePeqdpkplpylredr..adtafdielevslkteGlae....aavisrsnakslywtlkqqlahh 337 aq +P +dp plpylr++ af iel+v l++e ++ + ++sr a ++ywt++q+++hh lcl|NCBI__GCF_000013325.1:WP_011446105.1 279 AQpPRPLGDPDPLPYLRDEAdrMAGAFAIELSVWLTSEQMRAgrypPLRLSRGPASNMYWTIAQMVTHH 347 *989*************986325679***********99988788899********************* PP TIGR01266 338 svnGcnlraGdllgsGtisGkeeeafGsllelsakGkkevkladgetrkfledGdevilrgvckkeGvr 406 + nGc l++Gdllg+GtisG+e+++ Gsl+e+s +G+ +v+l getr+fl dGde+ +++++ G lcl|NCBI__GCF_000013325.1:WP_011446105.1 348 ASNGCGLNSGDLLGTGTISGTEQGSKGSLIEISEGGRVPVELPTGETRTFLLDGDEISFSATATAPGRA 416 *******************************************************************99 PP TIGR01266 407 .vGfGecaGkvlpa 419 +GfGec+ + pa lcl|NCBI__GCF_000013325.1:WP_011446105.1 417 pIGFGECRAVIRPA 430 9*******998876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (420 nodes) Target sequences: 1 (431 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.49 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory