Align L-lactaldehyde reductase (EC 1.1.1.77) (characterized)
to candidate WP_011459150.1 DHAF_RS02645 alcohol dehydrogenase
Query= metacyc::STM4044-MONOMER (382 letters) >NCBI__GCF_000021925.1:WP_011459150.1 Length = 387 Score = 313 bits (801), Expect = 7e-90 Identities = 167/377 (44%), Positives = 243/377 (64%), Gaps = 2/377 (0%) Query: 7 LPKISLHGAGAIADMVNLVANKQWGK-ALIVTDGQLVKLGLLDSLFSALDEHQMSYHLFD 65 +P ++L GAGA A A GK AL+VTD L + GL + ++ + ++ Sbjct: 12 MPTVNLMGAGA-AQEAGKQAKILGGKTALLVTDAFLNQSGLAKQIAEIIEAEGVKVVIYP 70 Query: 66 EVFPNPTEELVQKGFAAYQSAECDYIIAFGGGSPIDTAKAVKILTANPGPSTAYSGVGKV 125 PNPT++ V G A ++ C+ I++ GGGS D AK V ++ N G + GV K Sbjct: 71 GAEPNPTDKNVHDGVAVFEKENCNMIVSLGGGSAHDCAKGVGLVAGNGGNIRDFEGVDKS 130 Query: 126 KNAGVPLVAINTTAGTAAEMTSNAVIIDSARKVKEVIIDPNIIPDIAVDDASVMLEIPAS 185 VP++A+NTTAGTA+EMT +I D+ R +K I+D + P+++++D +M+ PA Sbjct: 131 AKPMVPMIAVNTTAGTASEMTRFCIITDTDRHIKMAIVDWHATPNVSINDPLLMIGKPAP 190 Query: 186 VTAATGMDALTHAVEAYVSVGAHPLTDANALEAIRLINLWLPKAVDDGHNLEAREQMAFG 245 +TAATGMDALTHAVEAYVS A P+TD+ AL AI+LI+ +L +AV +G + EAR+QMA+ Sbjct: 191 LTAATGMDALTHAVEAYVSTAATPITDSAALMAIKLISKYLRRAVANGQDFEARDQMAYA 250 Query: 246 QYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIVENFNRPNAVARFARIAQA 305 Q+LAGMAFN+A LG VHA+AHQ G +NLPHGVCNAILLP V FN + RF IA+A Sbjct: 251 QFLAGMAFNNASLGYVHAMAHQLGGFYNLPHGVCNAILLPRVSRFNLIGNLERFVDIAEA 310 Query: 306 MGVETRGMSDEAASQEAINAIRTLSKRVGIPEGFSKLGVTKEDIEGWLDKALADPCAPCN 365 +G E + +S A+++A+ A+ TLS+ + IP G ++LGV +ED++ A+ D C+ N Sbjct: 311 LGEEIKNLSARDAAEKALTAMTTLSQDISIPSGLTELGVKEEDLQTMAVNAMKDACSLTN 370 Query: 366 PRTASRDEVRGLYLEAL 382 PR A +++ +Y +L Sbjct: 371 PRLAKLEDIIQIYKNSL 387 Lambda K H 0.317 0.133 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 403 Number of extensions: 21 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 387 Length adjustment: 30 Effective length of query: 352 Effective length of database: 357 Effective search space: 125664 Effective search space used: 125664 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory