Align fumarylacetoacetase (EC 3.7.1.2) (characterized)
to candidate WP_011459931.1 DHAF_RS15245 FAA hydrolase family protein
Query= BRENDA::A0A076VF18 (308 letters) >NCBI__GCF_000021925.1:WP_011459931.1 Length = 251 Score = 129 bits (323), Expect = 9e-35 Identities = 83/227 (36%), Positives = 122/227 (53%), Gaps = 26/227 (11%) Query: 68 LLSPLAPTDVPAIRGMGLQYSG---DPANPQDKPPVACLFFKASQALAGPGDDIVLPRLA 124 LL+P+ PT + I GL Y+ + + PV +F K +L GP D+I+LP A Sbjct: 48 LLAPVEPTKIVCI---GLNYAKHIEELGHDFHDDPV--IFLKPVTSLVGPEDEIILP--A 100 Query: 125 RDEKNDYEVELCVVLGKDAKDVDEKDAMSFVGGYCVVNDVSSRGLCAKGGQWGMGKSYDT 184 ++ DYE EL VV+GK AKD+ E A ++ G+ NDV++R L K GQW K +DT Sbjct: 101 MSQQVDYEAELVVVIGKTAKDLAEDQAEDYIFGFTCGNDVTARDLQKKDGQWTRSKGFDT 160 Query: 185 WCPFGPCLVSPSALGADPHKLTITTHVNGKLAQKGNTADLVLKIPELIARLSHGTTLQAG 244 +CP GP +V D + I + +NG++ Q T+ L+ +P+L++ +S TL G Sbjct: 161 FCPIGPWIVR----DLDYRNVKIRSVLNGEVKQSSQTSHLIHSVPKLVSYISKIMTLNPG 216 Query: 245 SLILTGSPIALGRKAPGDAVEQSPFMKDGDEIRCFVEGCGTLINSVR 291 LI+TG+P +G MK GD I ++G G L N VR Sbjct: 217 DLIMTGTPEGVGP------------MKTGDAIAIDIKGIGRLHNLVR 251 Lambda K H 0.316 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 204 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 251 Length adjustment: 25 Effective length of query: 283 Effective length of database: 226 Effective search space: 63958 Effective search space used: 63958 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory