Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate WP_011460079.1 DHAF_RS16410 PLP-dependent aminotransferase family protein
Query= BRENDA::A0A060PQX5 (417 letters) >NCBI__GCF_000021925.1:WP_011460079.1 Length = 386 Score = 278 bits (711), Expect = 2e-79 Identities = 149/380 (39%), Positives = 230/380 (60%), Gaps = 8/380 (2%) Query: 34 VRELLKLVESSDVISLAGGLPAPETFPVEIIAEITKEVLEKHAAQALQYGTTKGFTPLRL 93 + E+L+ ++ +IS AGGLPA + FP + + ++V E+ ALQY T G+ LR Sbjct: 15 IGEMLRAAQNPAMISFAGGLPALDLFPTQDLQAAFQKVFEEQGNAALQYAQTAGYPELRS 74 Query: 94 ALAEWMRKRYDIPISKVDIMITSGSQQALDLIGRVFINPGDIVVVEAPTYLAALQAFKYY 153 +A +R P +++IT+GSQQ L L+ + F++PGD V +E PTYL A+QAF+ + Sbjct: 75 WVAS-QHQRSQRPARTAEVIITTGSQQGLSLLAQTFLDPGDTVFLETPTYLGAIQAFEGF 133 Query: 154 EPEFVQIPLDDEGMRVDLLEEKLQELEKEGKKVKLVYTIPTFQNPAGVTMSEKRRKRLLE 213 +F IP D+EG+ D LE+ L K +Y IP +QNP+G M +RRK LL+ Sbjct: 134 RADFQMIPCDEEGILPDELEKALAFTTP-----KFLYLIPNYQNPSGRVMGLERRKELLK 188 Query: 214 LASEYDFLIVEDNPYGELRYSGEPVKPIKAWDDEGRVMYLGTFSKILAPGFRIGWIAAEP 273 ++ +Y L+VEDNPYGELRY GEP+ + + V+YLGTFSK+LAPG RIG++ A+ Sbjct: 189 VSQKYGLLLVEDNPYGELRYEGEPIPHLAELGEN--VIYLGTFSKVLAPGLRIGYVLADE 246 Query: 274 HLIRKLEIAKQSVDLCTNPFSQVIAWKYVEGGHLDNHIPNIIEFYKPRRDAMLKALEEFM 333 +I LE K+ VDL +N +Q ++Y++ L +HI + E Y RR AM+++++ ++ Sbjct: 247 DIIMHLEQTKEGVDLHSNNLTQRAIYEYLQKDLLPDHILKLREVYNVRRKAMVESIQTYL 306 Query: 334 PEGVRWTKPEGGMFVWVTLPEGIDTKLMLEKAVAKGVAYVPGEAFFAHRDVKNTMRLNFT 393 + V P GG+F+W L ++ ++ + + V YVPG F+A V N MRLN++ Sbjct: 307 GDRVEMKVPAGGLFLWAKLMGVNNSFDYVQDMIRQNVLYVPGALFYADGRVSNEMRLNYS 366 Query: 394 YVPEEKIREGIKRLAETIKE 413 E I EG++RLA + + Sbjct: 367 CSTPEIIEEGMRRLARGLNQ 386 Lambda K H 0.318 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 436 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 386 Length adjustment: 31 Effective length of query: 386 Effective length of database: 355 Effective search space: 137030 Effective search space used: 137030 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory