Align major cell-binding factor (characterized)
to candidate WP_011461725.1 DHAF_RS05225 amino acid ABC transporter substrate-binding protein
Query= CharProtDB::CH_021449 (259 letters) >NCBI__GCF_000021925.1:WP_011461725.1 Length = 278 Score = 262 bits (670), Expect = 5e-75 Identities = 134/237 (56%), Positives = 167/237 (70%), Gaps = 2/237 (0%) Query: 25 NAAEGKLESIKSKGQLIVGVKNDVPHYALLDQATGEIKGFEVDVAKLLAKSILGDDKKIK 84 + A +++IK +G L VGVK DVP + D T I GFE+D+ K LA+ I GD KIK Sbjct: 42 SGAPADVQAIKDRGALSVGVKVDVPGFGYKDPKTNVIDGFEIDLVKALAEEIFGDPSKIK 101 Query: 85 LVAVNAKTRGPLLDNGSVDAVIATFTITPERKRIYNFSEPYYQDAIGLLVLKEKKYKSLA 144 L AV AKTRGPLLD+G VD V+ATFTIT +RK+ YNFS+PYY D +GLLV K YKSL Sbjct: 102 LQAVTAKTRGPLLDSGDVDMVVATFTITEDRKKSYNFSDPYYIDGVGLLVKKAPGYKSLK 161 Query: 145 DMKGANIGVAQAATTKKAIGEAAKKIGIDVKFSEFPDYPSIKAALDAKRVDAFSVDKSIL 204 D+ G NIGVAQ+AT+K A+ A K+G+ VKF EF YP IKAALD+ RVDAFSVD+SIL Sbjct: 162 DLDGKNIGVAQSATSKTAVQAEADKLGVKVKFQEFATYPEIKAALDSGRVDAFSVDRSIL 221 Query: 205 LGYVDDKSEILPDSFEPQSYGIVTKKDDPAFAKYVDDFVKEHK--NEIDALAKKWGL 259 LGY+DD + +L D F PQ YG+ +K + AK V+D + E K E+D L +KWGL Sbjct: 222 LGYIDDSTMLLDDKFSPQEYGVASKLGNDGLAKLVNDKIAEMKGNGELDKLIEKWGL 278 Lambda K H 0.316 0.135 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 232 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 278 Length adjustment: 25 Effective length of query: 234 Effective length of database: 253 Effective search space: 59202 Effective search space used: 59202 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory