GapMind for catabolism of small carbon sources

 

Protein WP_011603682.1 in Frankia alni ACN14A

Annotation: NCBI__GCF_000058485.1:WP_011603682.1

Length: 393 amino acids

Source: GCF_000058485.1 in NCBI

Candidate for 15 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
xylitol catabolism PS417_12060 med ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family; SubName: Full=Sugar ABC transporter permease (characterized, see rationale) 33% 94% 160.2 Ribose import permease protein RbsC 32% 156.0
D-ribose catabolism rbsC med Ribose import permease protein RbsC (characterized) 32% 93% 156 EryF aka RB0338, component of The erythritol permease, EryEFG (Geddes et al., 2010) (probably orthologous to 3.A.1.2.16) 32% 151.0
D-mannose catabolism HSERO_RS03645 lo ABC-type sugar transport system, permease component protein (characterized, see rationale) 32% 89% 149.4 Ribose import permease protein RbsC 32% 156.0
D-cellobiose catabolism mglC lo MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized) 33% 92% 139.4 Ribose import permease protein RbsC 32% 156.0
D-galactose catabolism mglC lo MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized) 33% 92% 139.4 Ribose import permease protein RbsC 32% 156.0
D-glucose catabolism mglC lo MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized) 33% 92% 139.4 Ribose import permease protein RbsC 32% 156.0
lactose catabolism mglC lo MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized) 33% 92% 139.4 Ribose import permease protein RbsC 32% 156.0
D-maltose catabolism mglC lo MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized) 33% 92% 139.4 Ribose import permease protein RbsC 32% 156.0
sucrose catabolism mglC lo MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized) 33% 92% 139.4 Ribose import permease protein RbsC 32% 156.0
trehalose catabolism mglC lo MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized) 33% 92% 139.4 Ribose import permease protein RbsC 32% 156.0
D-fructose catabolism frcC lo Ribose ABC transport system, permease protein RbsC (characterized, see rationale) 33% 94% 136.3 Ribose import permease protein RbsC 32% 156.0
sucrose catabolism frcC lo Ribose ABC transport system, permease protein RbsC (characterized, see rationale) 33% 94% 136.3 Ribose import permease protein RbsC 32% 156.0
L-fucose catabolism BPHYT_RS34240 lo Monosaccharide-transporting ATPase; EC 3.6.3.17; Flags: Precursor (characterized, see rationale) 32% 83% 131.7 Ribose import permease protein RbsC 32% 156.0
L-rhamnose catabolism BPHYT_RS34240 lo Monosaccharide-transporting ATPase; EC 3.6.3.17; Flags: Precursor (characterized, see rationale) 32% 83% 131.7 Ribose import permease protein RbsC 32% 156.0
myo-inositol catabolism PS417_11895 lo m-Inositol ABC transporter, permease component (iatP) (characterized) 31% 83% 129.4 Ribose import permease protein RbsC 32% 156.0

Sequence Analysis Tools

View WP_011603682.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MKAQLRITEFFERYGLVALLVAVIVFFSVNSATPQFDTVANLRNILTDQSILGILAIATV
IPLVAGQIDLSVGPNAGLTSVLCAGLMSKSGWPLFPAILAAIVVGLVIGTINAILVASVG
INSIIATLGMSSVIGAAVLAYSGGVSITTGVSPGLLRLGPGKWLSVPTLFYFLLGIALVA
WYLLEKTPTGKNLYAIGSNPRAALLVGIGVSRQTFGSLVLAGGIAGGAGVLLVAAVGAGS
PQLGSNYTLPAIAAAFLGATSIQPGRYNVWGTITAVFFLAISVNGLTLWGAAPWVSELFD
GAALIVGVGLGVYAGALRRRRPGRRGTASPDEMAAAATTAPHDAPPVLDAPPVLDAPPVL
DAPPVLDGADDTDGSDRRPTNVTQDAGANRAGP

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory