Align phenylpyruvate decarboxylase (EC 4.1.1.43) (characterized)
to candidate WP_011604188.1 FRAAL_RS13280 thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha
Query= BRENDA::A0A222AKA3 (368 letters) >NCBI__GCF_000058485.1:WP_011604188.1 Length = 342 Score = 155 bits (391), Expect = 2e-42 Identities = 108/311 (34%), Positives = 158/311 (50%), Gaps = 19/311 (6%) Query: 23 VTAAPAAAAPAAAGVPPDR--QLLMYRAMVVGRAFNRQATAFSRQGRLA-VYPSSRGQEA 79 ++A P +AA PPD QL ++R F+ + + G + +Y S RGQE Sbjct: 3 ISAPPDSAAAVDFSAPPDLDVQLGLFRTATRIARFDEKYRSLMTSGAIGGMYYSPRGQEF 62 Query: 80 CQVGSALAVRPTDWLFPTYRESVALLTRGIDPVQVLTLFRGDQH--CGYDPVTEH-TAPQ 136 A +R D++ TYR + +G+ ++ + G CG H TAP+ Sbjct: 63 AAASVAAHLRRDDYVVTTYRGLHDQIAKGVPLRELWAEYLGKAAGTCGGKGGPMHVTAPE 122 Query: 137 CTPLATQCLH------AAGLADAARMAGDPIVALAYIGDGATSEGDFHEALNYAAVRRAP 190 + T + A GLA +A++ G V + GDGA++ G FHE+LN A++ R P Sbjct: 123 YGLMVTTGVVGSGLPIANGLALSAQLRGTDQVTVVNFGDGASNIGAFHESLNLASIWRLP 182 Query: 191 VVFLVQNNQYAISVPLAKQTAARTLADKAAGYGMPGVRIDGNDVLQVYRAVHDAAERARA 250 V+F+ QNN+YA PL + T+ +A +AA Y +PGV +DGND +++Y A A ERAR Sbjct: 183 VIFVCQNNRYAEYTPLREGTSVDRIAQRAAAYSLPGVTVDGNDPIELYNAAGAAIERART 242 Query: 251 GHGPTLIEAVTYRIDAHTNADDDTRYRPAGEADVWAAQDPVDRLERDLLA------AGVL 304 G GPTL+EA+T+R H D Y P E A DP+ R L A + Sbjct: 243 GGGPTLLEAMTFRFCGHIMGDQQV-YMPPEELRAAIAADPLVRFRAQLAADVGEDELAAV 301 Query: 305 DRAAADGIAAA 315 +RAAAD +A A Sbjct: 302 ERAAADEVADA 312 Lambda K H 0.319 0.132 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 295 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 368 Length of database: 342 Length adjustment: 29 Effective length of query: 339 Effective length of database: 313 Effective search space: 106107 Effective search space used: 106107 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory