Align Glucokinase; EC 2.7.1.2; Glucose kinase (uncharacterized)
to candidate WP_011610590.1 TERY_RS03685 glucokinase
Query= curated2:B2J224 (341 letters) >NCBI__GCF_000014265.1:WP_011610590.1 Length = 351 Score = 430 bits (1106), Expect = e-125 Identities = 221/351 (62%), Positives = 267/351 (76%), Gaps = 10/351 (2%) Query: 1 MTLLLAGDIGGTKTILQLVETSDSQG-----LHTIYQESYHSADFPDLVPIVQQFLIKAN 55 MTLL+AGDIGGTKTILQLVE + + L +Y+ Y S DFPDLVPIV++FL +A+ Sbjct: 1 MTLLVAGDIGGTKTILQLVEVNREESKASVELRKLYENRYLSNDFPDLVPIVKKFLEEAS 60 Query: 56 TPI-----PEKACFAIAGPIVKNTAKLTNLAWFLDTERLQQELGIPHIYLINDFAAVGYG 110 + PEKACFAIAGP+V N KLTNL W +D + ++ ELGI I LINDF AVGYG Sbjct: 61 EKLGEKQKPEKACFAIAGPVVNNIVKLTNLPWIIDAKLMENELGISQISLINDFEAVGYG 120 Query: 111 ISGLQKQDLHPLQVGKPQPETPIGIIGAGTGLGQGFLIKQGNNYQVFPSEGGHADFAPRN 170 I GL +DL LQ G+P+ +TPI +IGAGTGLGQ FLI+ +V+P+EGGH DF R+ Sbjct: 121 ILGLNTKDLETLQPGEPKSDTPIAVIGAGTGLGQCFLIRAAGVIKVYPTEGGHTDFKARS 180 Query: 171 EIEFQLLKYLLDKHDIQRISVERVVSGMGIVAIYQFLRDRKFAAESPDIAQIVRTWEQEA 230 ++EF LLKYL H+I+R+SVERVVSGMGIVAIYQFLRD FA ESP+I +R WE+E Sbjct: 181 QLEFDLLKYLKKLHNIKRVSVERVVSGMGIVAIYQFLRDSLFATESPEIGDQIRQWEKEV 240 Query: 231 GQEEKSVDPGAAIGTAALEKRDRLSEQTLQLFIEAYGAEAGNLALKLLPYGGLYIAGGIA 290 G + +VDPGA IG AALEK D L EQTL++FIEAYGAEAGNLALKLLPY GLYIAGGIA Sbjct: 241 GSNQITVDPGAVIGKAALEKSDPLCEQTLKMFIEAYGAEAGNLALKLLPYSGLYIAGGIA 300 Query: 291 PKILPLIQNSGFLLNFTQKGRMRPLLEEIPVYIILNPQVGLIGAALCAARL 341 KI+PLI + F+ F KGRM+PLLE+IPV++ILNP VGLIGAA+ A+ L Sbjct: 301 AKIIPLINSGSFMEAFKDKGRMKPLLEKIPVHVILNPHVGLIGAAIRASNL 351 Lambda K H 0.320 0.140 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 351 Length adjustment: 29 Effective length of query: 312 Effective length of database: 322 Effective search space: 100464 Effective search space used: 100464 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_011610590.1 TERY_RS03685 (glucokinase)
to HMM TIGR00749 (glk: glucokinase (EC 2.7.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00749.hmm # target sequence database: /tmp/gapView.26634.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00749 [M=315] Accession: TIGR00749 Description: glk: glucokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-109 351.4 0.1 2.9e-109 351.1 0.1 1.0 1 lcl|NCBI__GCF_000014265.1:WP_011610590.1 TERY_RS03685 glucokinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000014265.1:WP_011610590.1 TERY_RS03685 glucokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 351.1 0.1 2.9e-109 2.9e-109 2 315 .] 6 345 .. 5 345 .. 0.92 Alignments for each domain: == domain 1 score: 351.1 bits; conditional E-value: 2.9e-109 TIGR00749 2 vgdiGGtnarlalvevapgeieqv........ktyssedfpsleavvrvyleeakvelkd...pikgcf 59 +gdiGGt+++l lvev e ++ + y s+dfp+l+++v+ +leea ++l++ p k+cf lcl|NCBI__GCF_000014265.1:WP_011610590.1 6 AGDIGGTKTILQLVEVNREESKASvelrklyeNRYLSNDFPDLVPIVKKFLEEASEKLGEkqkPEKACF 74 79************8776665544466666888999**********************8755677**** PP TIGR00749 60 aiatPiigdfvrltnldWalsieelkqelalaklelindfaavayailalkeedliqlggakveesaai 128 aia+P+++++v+ltnl W + + +++el+++++ lindf av+y+il+l+ +dl l+ +++ +++i lcl|NCBI__GCF_000014265.1:WP_011610590.1 75 AIAGPVVNNIVKLTNLPWIIDAKLMENELGISQISLINDFEAVGYGILGLNTKDLETLQPGEPKSDTPI 143 ********************************************************************* PP TIGR00749 129 ailGaGtGlGvatliqqsdgrykvlageGghvdfaPrseleillleylrkky..grvsaervlsGsGlv 195 a++GaGtGlG+++li+ + g kv+++eGgh+df rs+le+ ll+yl+k rvs+erv+sG+G+v lcl|NCBI__GCF_000014265.1:WP_011610590.1 144 AVIGAGTGLGQCFLIR-AAGVIKVYPTEGGHTDFKARSQLEFDLLKYLKKLHniKRVSVERVVSGMGIV 211 ***************9.99******************************865449************** PP TIGR00749 196 liyealskrkgere...vsklskeelkekd...........iseaalegsdvlarralelflsilGala 250 iy++l+ e + +++ ke i +aale sd+l++++l++f+ ++Ga+a lcl|NCBI__GCF_000014265.1:WP_011610590.1 212 AIYQFLRDSLFATEspeIGDQIRQWEKEVGsnqitvdpgavIGKAALEKSDPLCEQTLKMFIEAYGAEA 280 *******987666544543334444444336666*********************************** PP TIGR00749 251 gnlalklgarGGvyvaGGivPrfiellkkssfraafedkGrlkellasiPvqvvlkkkvGllGag 315 gnlalkl+++ G+y+aGGi+ ++i+l++++sf++af+dkGr+k ll++iPv+v+l+ +vGl+Ga+ lcl|NCBI__GCF_000014265.1:WP_011610590.1 281 GNLALKLLPYSGLYIAGGIAAKIIPLINSGSFMEAFKDKGRMKPLLEKIPVHVILNPHVGLIGAA 345 ***************************************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (315 nodes) Target sequences: 1 (351 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 12.03 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory