Align ribokinase (characterized)
to candidate WP_011610662.1 TERY_RS04075 ribokinase
Query= CharProtDB::CH_024905 (309 letters) >NCBI__GCF_000014265.1:WP_011610662.1 Length = 305 Score = 232 bits (592), Expect = 7e-66 Identities = 127/301 (42%), Positives = 181/301 (60%), Gaps = 1/301 (0%) Query: 6 SLVVLGSINADHILNLQSFPTPGETVTGNHYQVAFGGKGANQAVAAGRSGANIAFIACTG 65 S+++ GS+N D I PTPGET+ GN++ A GGKGANQAVAA G + G Sbjct: 2 SIIIFGSVNIDLIATTPRLPTPGETINGNNFFTAGGGKGANQAVAAAGLGIPTKIVGRVG 61 Query: 66 DDSIGESVRQQLATDNIDITPVSVIKGESTGVALIFVNGEGENVIGIHAGANAALSPALV 125 +DS G+ + L+T N+D T V V + TGVA+I V GEN I + GAN +++ V Sbjct: 62 NDSFGQQLLVSLSTANVDTTDVLVDENTHTGVAVIAVGASGENNIIVVPGANHSINNTDV 121 Query: 126 EAQRERIANASALLMQLESPLESVMAAAKIAHQNKTIVALNPAP-ARELPDELLALVDII 184 E + +++ +ALL+QLE P+E ++AAK+A + V L+PAP P++ L+DII Sbjct: 122 ERLKNLLSDVTALLLQLEIPVEVAISAAKVAQEMGVKVILDPAPMPANFPNDFYNLIDII 181 Query: 185 TPNETEAEKLTGIRVENDEDAAKAAQVLHEKGIRTVLITLGSRGVWASVNGEGQRVPGFR 244 TPNE EA +L G V N E A +AA L +G++ ++ +G RGV + E P F Sbjct: 182 TPNEIEASQLVGFEVNNQETAMEAAVELCHRGVKNAVVKIGDRGVICATKEEAFFQPAFV 241 Query: 245 VQAVDTIAAGDTFNGALITALLEEKPLPEAIRFAHAAAAIAVTRKGAQPSVPWREEIDAF 304 V+ +DT+AAGD FNG L AL L EA+++ AA A+ T+ GAQP++P R+ D F Sbjct: 242 VKTIDTVAAGDAFNGGLAAALDTGLSLKEAVKWGAAAGALCTTKPGAQPAMPDRKTFDNF 301 Query: 305 L 305 L Sbjct: 302 L 302 Lambda K H 0.314 0.131 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 305 Length adjustment: 27 Effective length of query: 282 Effective length of database: 278 Effective search space: 78396 Effective search space used: 78396 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
Align candidate WP_011610662.1 TERY_RS04075 (ribokinase)
to HMM TIGR02152 (rbsK: ribokinase (EC 2.7.1.15))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02152.hmm # target sequence database: /tmp/gapView.4025684.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02152 [M=298] Accession: TIGR02152 Description: D_ribokin_bact: ribokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-100 322.4 7.7 1.7e-100 322.2 7.7 1.0 1 NCBI__GCF_000014265.1:WP_011610662.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000014265.1:WP_011610662.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 322.2 7.7 1.7e-100 1.7e-100 1 295 [. 3 297 .. 3 300 .. 0.99 Alignments for each domain: == domain 1 score: 322.2 bits; conditional E-value: 1.7e-100 TIGR02152 1 ivvvGSinvDlvlrvkrlpkpGetvkaeefkiaaGGKGANQAvaaarlgaevsmigkvGkDefgeellenlkk 73 i+++GS+n+Dl+++++rlp pGet+++++f +a GGKGANQAvaaa lg ++++g+vG+D+fg++ll +l++ NCBI__GCF_000014265.1:WP_011610662.1 3 IIIFGSVNIDLIATTPRLPTPGETINGNNFFTAGGGKGANQAVAAAGLGIPTKIVGRVGNDSFGQQLLVSLST 75 89*********************************************************************** PP TIGR02152 74 egidteyvkkvkktstGvAlilvdeegeNsIvvvaGaneeltpedvkaaeekikesdlvllQlEipletveea 146 ++dt+ v +++t+tGvA+i v +geN+I+vv Gan++++++dv++ ++ +++ + +llQlEip+e++++a NCBI__GCF_000014265.1:WP_011610662.1 76 ANVDTTDVLVDENTHTGVAVIAVGASGENNIIVVPGANHSINNTDVERLKNLLSDVTALLLQLEIPVEVAISA 148 ************************************************************************* PP TIGR02152 147 lkiakkagvkvllnPAPaekkldeellslvdiivpNetEaeiLtgievedledaekaaekllekgvkaviitl 219 +k+a++ gvkv+l+PAP ++ ++++++l+dii+pNe Ea++L+g ev+++e+a +aa +l ++gvk+ ++++ NCBI__GCF_000014265.1:WP_011610662.1 149 AKVAQEMGVKVILDPAPMPANFPNDFYNLIDIITPNEIEASQLVGFEVNNQETAMEAAVELCHRGVKNAVVKI 221 ************************************************************************* PP TIGR02152 220 GskGallvskdekklipalkvkavDttaAGDtFigalavaLaegksledavrfanaaaalsVtrkGaqssiPt 292 G++G+++++k+e + pa+ vk++Dt+aAGD+F+g+la+aL++g sl++av+ ++aa al t+ Gaq+++P NCBI__GCF_000014265.1:WP_011610662.1 222 GDRGVICATKEEAFFQPAFVVKTIDTVAAGDAFNGGLAAALDTGLSLKEAVKWGAAAGALCTTKPGAQPAMPD 294 ************************************************************************9 PP TIGR02152 293 kee 295 ++ NCBI__GCF_000014265.1:WP_011610662.1 295 RKT 297 986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (305 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 20.41 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory