Align Aldehyde dehydrogenase; NAD/NADP-dependent aldehyde dehydrogenase; EC 1.2.1.3; EC 1.2.1.4 (characterized)
to candidate WP_011611554.1 TERY_RS09080 NAD-dependent succinate-semialdehyde dehydrogenase
Query= SwissProt::Q8GAK7 (458 letters) >NCBI__GCF_000014265.1:WP_011611554.1 Length = 455 Score = 426 bits (1095), Expect = e-124 Identities = 225/457 (49%), Positives = 302/457 (66%), Gaps = 5/457 (1%) Query: 1 MAIATIDPTTGITLKTFDAHTPEEVENRIARAEAAFRSLQNTSFEERARWMHKAADILES 60 M IAT++P TG LKTF+ T ++E ++ AE FR+ TS +R W+ AADILE Sbjct: 1 MQIATVNPATGEVLKTFEQITDTQIEAKLELAEKTFRAYCQTSITQRGEWLLAAADILEK 60 Query: 61 EADEVARLIATEMGKTLTTAKYEALKSATGMRHFADHAQRYLSPETPVPASEVNASNLHV 120 A++ +++ EMGKT++ A EA K A R++A+ A +L+ VPA + +AS V Sbjct: 61 NAEKFGKIMTLEMGKTISGAIAEAKKCALVCRYYAEKATEFLAD---VPA-QTDASKSFV 116 Query: 121 QFDPLGVVLAVMPWNYPLWQAVRFAAPALMAGNTGLLKHASNVPQCALYLGDLFARGGFP 180 ++ P+G VLAVMPWN+P WQ RFAAPALMAGN GLLKHASNVPQCAL + ++F GFP Sbjct: 117 RYQPIGPVLAVMPWNFPFWQVFRFAAPALMAGNVGLLKHASNVPQCALAIEEIFQEAGFP 176 Query: 181 EGAFQTLLVEGKDVIPLVDDARIRAVTLTGSVAAGSAIAEAAGRNIKRSVLELGGMDVFI 240 EG FQTLL+ V ++ D R++A TLTGS AG+++A AGR IK++VLELGG D FI Sbjct: 177 EGVFQTLLISSDKVSGIMMDDRVKAGTLTGSEPAGASLAATAGRAIKKTVLELGGSDPFI 236 Query: 241 VMPSADIEKAAAQAVIARLQNSGQSCIAAKRFYVHEDVYDRFEHLFVTGMAEAVAGDPLD 300 V+ SAD+E A AV AR+ N+GQSCIAAKRF + + + D+F+ V GDP+ Sbjct: 237 VLESADLETAVTTAVTARMLNNGQSCIAAKRFILADAIADQFQEGLVEKFEALKVGDPML 296 Query: 301 ESTSFGPLATERGRQDVHELVRDAREKGAAVQCGGE-IPEGEGWYYPATVLTGVTEDMRI 359 T+ GPLAT ++++ V + EKGA + GG + + G +YP T+L + Sbjct: 297 PDTNIGPLATPSILEELNAQVEASVEKGAKILTGGHLLSDLPGNFYPPTILAEIPISSPA 356 Query: 360 YREECFGPVACLYKVSSLQEAIALSNDSDFGLSSSVWTNDETEATEAARSIEAGGVFING 419 Y+EE FGPVA +++V+++ EAI L+N++ FGL +S WT D E +EAG VFING Sbjct: 357 YQEEFFGPVALVFRVANIDEAINLANNTPFGLGASAWTKDTGETERLISELEAGAVFING 416 Query: 420 LTASFPAVPFGGLKDSGYGRELSAYGIREFVNIKTVW 456 L S P +PFGG+K SGYGRELS GI EFVNIKTVW Sbjct: 417 LVKSDPRLPFGGIKRSGYGRELSREGILEFVNIKTVW 453 Lambda K H 0.317 0.132 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 495 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 458 Length of database: 455 Length adjustment: 33 Effective length of query: 425 Effective length of database: 422 Effective search space: 179350 Effective search space used: 179350 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory