Align PEP1B, component of Uptake system for glutamate and aspartate (characterized)
to candidate WP_011611621.1 TERY_RS09445 amino acid ABC transporter permease
Query= TCDB::A1VZQ3 (250 letters) >NCBI__GCF_000014265.1:WP_011611621.1 Length = 388 Score = 81.6 bits (200), Expect = 2e-20 Identities = 49/143 (34%), Positives = 82/143 (57%), Gaps = 11/143 (7%) Query: 96 LVIQIFFLFYALPV----------LGIRLDIFTIGVLGVGAYHGAYVSEVVRSGILAVPR 145 L+I IF L + P+ L + L+I + ++G+ Y GA+++E+VRSGI AVP+ Sbjct: 227 LLIIIFALGWQAPIATETGGTKGGLNLTLEISAL-LVGLVFYTGAFIAEIVRSGIQAVPK 285 Query: 146 GQFEASASQGFTYIQQMRYIIVPQTIRIILPPMTNQMVNLIKNTSVLLIVGGAELMHSAD 205 GQ+EA+ S G MR +I PQ +R+++P + +Q +NL KN+S+ + +G +L A+ Sbjct: 286 GQWEAAKSLGLKPGLVMRLVIFPQALRVMIPSLNSQYMNLAKNSSLAIAIGYPDLYAVAN 345 Query: 206 SYAADYGNYAPAYIFAAVLYFII 228 + G +I V+Y I Sbjct: 346 TTYNQTGRPIEVFILIMVVYLSI 368 Score = 55.1 bits (131), Expect = 2e-12 Identities = 30/102 (29%), Positives = 57/102 (55%), Gaps = 4/102 (3%) Query: 10 HLRQILTSWGLYDENSISPFAVWKFLDALDNKDAFIN----GFIYTLEVSILALLIATIF 65 +L Q T +G ++ + F++ + L + D +I G +L V IL + + TI Sbjct: 44 NLAQQGTRFGFSFLDNEAAFSISESLIPYEASDPYIQVLLAGLFNSLRVMILGIFLTTIL 103 Query: 66 GTIGGVMATSRFKIIRAYTRIYVELFQNVPLVIQIFFLFYAL 107 G + G+ + S ++R R+YVE+ +N PL++Q+FF ++A+ Sbjct: 104 GIVAGIASFSENWLLRNLNRVYVEVVRNTPLLLQLFFWYFAV 145 Lambda K H 0.328 0.143 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 250 Length of database: 388 Length adjustment: 27 Effective length of query: 223 Effective length of database: 361 Effective search space: 80503 Effective search space used: 80503 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory