Align Glucosamine-6-phosphate deaminase; EC 3.5.99.6; GlcN6P deaminase; GNPDA; Glucosamine-6-phosphate isomerase (uncharacterized)
to candidate WP_011612184.1 TERY_RS12565 glucosamine-6-phosphate deaminase
Query= curated2:B1YJ30 (252 letters) >NCBI__GCF_000014265.1:WP_011612184.1 Length = 269 Score = 140 bits (354), Expect = 2e-38 Identities = 89/237 (37%), Positives = 130/237 (54%), Gaps = 7/237 (2%) Query: 6 VEKAEELANVSYQLLKQEIVRHPEGLTIGLATGSSPLGVYEEWRK-DRVDCRHVTTVNLD 64 +E A++ A + L+ I RH + I LATG+S + +D VT +LD Sbjct: 33 LEMAKDAALSVLEYLQNLITRHRKANVI-LATGNSQIMFLRALTTLGGIDWSQVTLFHLD 91 Query: 65 EYVGLSPDHPHSYHTFMQEHLFDAVDFKESYVPIGSTADPREESDRYEALVRQLGIDIQL 124 EY+G+S DHP S+ ++QE + + ++ + G T +P EE DRY L+ ID+ L Sbjct: 92 EYLGISADHPASFRYYLQEKVEKFITPRQFHYIQGDTNEPLEECDRYTQLLSAQPIDLVL 151 Query: 125 LGIGSNGHIAFNEPGT-----PFDAKTHVTKLTESTRQANQRFFDRLEDVPTEAITMGIG 179 LGIG NGH+AFN+P P K LT +Q NQ F L+ VP A T+ I Sbjct: 152 LGIGDNGHLAFNDPSVANFNDPQTIKLVKLDLTSRQQQVNQGHFPHLDAVPQYAFTVTIP 211 Query: 180 TIMEAKKILLVASSERKAEAIRDMMEGPATTDCPATILQRHADVMVVLDEEAASLLS 236 I AKKI +A +RKAE IR+++ P +T PA+IL++ + + LD +ASL+S Sbjct: 212 AICSAKKIFCLAPEKRKAEVIRNILYNPISTIYPASILRQKSQATLFLDTNSASLIS 268 Lambda K H 0.317 0.132 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 269 Length adjustment: 24 Effective length of query: 228 Effective length of database: 245 Effective search space: 55860 Effective search space used: 55860 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory