Align NAD+-dependent L-lactaldehyde dehydrogenase (EC 1.2.1.22) (characterized)
to candidate WP_011612208.1 TERY_RS12690 aldehyde dehydrogenase
Query= metacyc::MONOMER-16246 (477 letters) >NCBI__GCF_000014265.1:WP_011612208.1 Length = 459 Score = 163 bits (413), Expect = 1e-44 Identities = 115/335 (34%), Positives = 164/335 (48%), Gaps = 12/335 (3%) Query: 137 LFRKPLGVVAGILPWNFPFFLIARKMAPALLTGNTIVVKPSEETPNNCFEFARLVAETDL 196 ++++PLGVV I WN+PF L+ + A+ GN ++KPSE N A L+A T Sbjct: 102 IYQEPLGVVLIIGAWNYPFQLVIHPLLGAIAAGNCAIIKPSEIAVNTSEVVADLIAHTFD 161 Query: 197 PRGVFNVVCGAGQVGGALSSHPGVDLISFTGSVETGARIMAAAAPNLTKLNLELGGKAPA 256 + V G + L+ D I FTG G +M AAA +LT + LELGGK+P Sbjct: 162 SSYIAAVTGGVEKSQQLLAEK--FDHIFFTGGTRVGKIVMEAAAKSLTPVTLELGGKSPC 219 Query: 257 IVLADADLELAVKAIRDSRIINSGQVCNCAERVYVQRQVAEPFIERIAAAMAATRYGDPL 316 IV D LE K I + IN+GQ C + + V + V +E+I ++ +P Sbjct: 220 IVDDDIQLEYTAKRITWGKFINAGQTCVAPDYLLVNKSVKSDLLEKIKQSIDKFYGKNPA 279 Query: 317 AEPEVEMGPLINRLGLEKIDAKVRTALAQGATLVTGGAIAERPGHHYQPTVLTGCRADTR 376 P + G +IN EK ++ L +G + G +E + PTV+ G D+ Sbjct: 280 NSP--DYGRIIN----EKQFNRLNHLLEEGKIFIGGETKSEE--LYISPTVIEGVNWDSG 331 Query: 377 IMREEIFGPVLPIQIVDDLDEAIALANDCEYGLTSSVFTRDLNKAMHALRELDFGETYIN 436 IM EEIFGP+LP+ ++LDEAIAL N L+ F+R+ K LRE G IN Sbjct: 332 IMEEEIFGPILPVLEYENLDEAIALVNSRPKPLSLYFFSRNKQKQEQVLRETSSGNVCIN 391 Query: 437 REHFEAMQGF--HAGVRKSGIGGADGKHGLYEYTH 469 + + F GV SGIG GK ++H Sbjct: 392 DTVMQFVVRFLPFGGVGNSGIGSYHGKASFDTFSH 426 Lambda K H 0.320 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 439 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 477 Length of database: 459 Length adjustment: 33 Effective length of query: 444 Effective length of database: 426 Effective search space: 189144 Effective search space used: 189144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory