Align Ornithine aminotransferase; Ornithine--oxo-acid aminotransferase; EC 2.6.1.13 (characterized)
to candidate WP_011612286.1 TERY_RS13140 glutamate-1-semialdehyde 2,1-aminomutase
Query= SwissProt::Q6CWC1 (437 letters) >NCBI__GCF_000014265.1:WP_011612286.1 Length = 432 Score = 128 bits (322), Expect = 3e-34 Identities = 96/336 (28%), Positives = 155/336 (46%), Gaps = 31/336 (9%) Query: 30 PVVFSRASGAHVWDPEGKEYLDFLSAYSAVNQGHCHPHIIQALVDQASKLTLSSRAFSND 89 P+VF R GA++WD +G +Y+D++ + GH HP ++ L + K T +F Sbjct: 40 PIVFDRVQGAYIWDVDGNQYIDYVGTWGPAICGHAHPEVLNGLKEVLEKGT----SFGAP 95 Query: 90 CFA--SFSKFVTEFF-GYESVLPMNTGAEAVESALKLARRWGYMVKKIQPNEAIILGARG 146 C + +K V + E + +N+G EA + L+L R + K I+ G Sbjct: 96 CALENTLAKMVIDAVPSIEMIRFVNSGTEACMAVLRLMRAFTGRDKVIK--------FEG 147 Query: 147 NFHGRT-FGAISLSTDEEDSRMNFGPFLENVTAKIPGGSDDEFIRYGEIDDYKRAFESHG 205 +HG + + + P + K + Y +++ K+ FE + Sbjct: 148 CYHGHADMFLVKAGSGVATLGLPDSPGVPKHVTK-----NTLTAPYNDLETVKKLFEENP 202 Query: 206 DKICAVIVEPIQGEAGIVVPRADFLTDLQELCKKHQVLLICDEIQTG--IARTGKLLCYE 263 D+I VI+EP+ G +G +VP A FL L+ + K++ LL+ DE+ TG IA G + Sbjct: 203 DQISGVILEPVVGNSGFIVPDAGFLEGLRMITKENGALLVFDEVMTGFRIAYGGA----Q 258 Query: 264 HSPNCKPDIILLGKAISGGVLPVSCVLSSREIMDCFTPGS---HGSTYGGNPLASRVAIA 320 N PD+ LGK I GG LPV ++IM P T GNPLA I Sbjct: 259 EKFNVTPDLTTLGKIIGGG-LPVGAYGGRQDIMSMVAPAGPMYQAGTLSGNPLAMTAGIK 317 Query: 321 ALEVVQNENLVERSARLGKFLQDELVKLQHESNGVI 356 LE+++ ++ ++ K L D L+ + E+N I Sbjct: 318 TLELLKKPGTYDQLNKITKRLADGLLNIAKETNNDI 353 Lambda K H 0.318 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 385 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 437 Length of database: 432 Length adjustment: 32 Effective length of query: 405 Effective length of database: 400 Effective search space: 162000 Effective search space used: 162000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory