Align 2-aminoadipate transaminase (EC 2.6.1.39) (characterized)
to candidate WP_011612286.1 TERY_RS13140 glutamate-1-semialdehyde 2,1-aminomutase
Query= reanno::Putida:PP_4108 (416 letters) >NCBI__GCF_000014265.1:WP_011612286.1 Length = 432 Score = 134 bits (336), Expect = 7e-36 Identities = 92/295 (31%), Positives = 144/295 (48%), Gaps = 21/295 (7%) Query: 15 PITLSHGRNAEVWDTDGKRYIDFVGGIGVLNLGHCNPAVVEAIQAQATRLTHYAFNAAPH 74 PI + A +WD DG +YID+VG G GH +P V+ ++ + T + Sbjct: 40 PIVFDRVQGAYIWDVDGNQYIDYVGTWGPAICGHAHPEVLNGLKEVLEKGTSF------- 92 Query: 75 GPYLALMEQLSQFVPVSYPLAGML--TNSGAEAAENALKVARGATGKRAIIAFDGGFHGR 132 G AL L++ V + P M+ NSG EA L++ R TG+ +I F+G +HG Sbjct: 93 GAPCALENTLAKMVIDAVPSIEMIRFVNSGTEACMAVLRLMRAFTGRDKVIKFEGCYHGH 152 Query: 133 T-LATLNLNGKVAPYKQRVGELPGPVYHLPYPSADTGVTCEQALKAMDRLFSVELAVEDV 191 + + VA + + PG H+ + +T L+ + +LF E + + Sbjct: 153 ADMFLVKAGSGVATLG--LPDSPGVPKHV---TKNTLTAPYNDLETVKKLF--EENPDQI 205 Query: 192 AAFIFEPVQGEGGFLALDPAFAQALRRFCDERGILIIIDEIQSGFGRTGQRFAFPRLGIE 251 + I EPV G GF+ D F + LR E G L++ DE+ +GF R A + + Sbjct: 206 SGVILEPVVGNSGFIVPDAGFLEGLRMITKENGALLVFDEVMTGF-RIAYGGAQEKFNVT 264 Query: 252 PDLLLLAKSIAGGMPLGAVVGRKELMAALPKGG---LGGTYSGNPISCAAALASL 303 PDL L K I GG+P+GA GR+++M+ + G GT SGNP++ A + +L Sbjct: 265 PDLTTLGKIIGGGLPVGAYGGRQDIMSMVAPAGPMYQAGTLSGNPLAMTAGIKTL 319 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 421 Number of extensions: 30 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 432 Length adjustment: 32 Effective length of query: 384 Effective length of database: 400 Effective search space: 153600 Effective search space used: 153600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory