Align ATPase (characterized, see rationale)
to candidate WP_011612342.1 TERY_RS13460 spermidine/putrescine ABC transporter ATP-binding protein
Query= uniprot:Q31RN8 (261 letters) >NCBI__GCF_000014265.1:WP_011612342.1 Length = 381 Score = 144 bits (362), Expect = 4e-39 Identities = 82/225 (36%), Positives = 129/225 (57%), Gaps = 12/225 (5%) Query: 37 ALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIWIEGHRLSHDRRDIATI 96 A+ GV +++GE ++GPSG GK+T LR + E+ GEI I G +S Sbjct: 33 AVKGVDFNIRQGEFFSILGPSGCGKTTTLRLIAGFETPSAGEIIIRGQSMSQT----PAY 88 Query: 97 RQEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEATARQLLERVRIAEQADKYPG 156 R+ V VFQ + LF HL+V N+ ++++R + E Q L+ V++ + AD+YP Sbjct: 89 RRPVNTVFQSYALFNHLSVKDNIAFG-LRIKRLGKTETEEKVAQALQLVKMEKFADRYPN 147 Query: 157 QLSGGQQQRVAIARALAMQPRILLFDEPTSALD----PEMVREVLDVMRDLASEGMTMLV 212 Q+SGGQQQRVA+ARAL +P +LL DEP ALD +M E+ ++ +DL G+T ++ Sbjct: 148 QISGGQQQRVALARALVNRPAVLLLDEPLGALDLKLRKQMQMELSNIHKDL---GVTFVM 204 Query: 213 ATHEVGFAREVADRVVLMADGQIVEEAPPDRFFTAPQSDRAKQFL 257 TH+ A ++DR+ +M +G+I + P + P+S F+ Sbjct: 205 VTHDQQEAMSMSDRIAVMHEGRIEQIGSPQEIYECPESPFVADFI 249 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 381 Length adjustment: 27 Effective length of query: 234 Effective length of database: 354 Effective search space: 82836 Effective search space used: 82836 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory