Align 4-hydroxybenzoate 3-monooxygenase (EC 1.14.13.2) (characterized)
to candidate WP_011612600.1 TERY_RS14940 cytochrome P450
Query= metacyc::MONOMER-20332 (453 letters) >NCBI__GCF_000014265.1:WP_011612600.1 Length = 444 Score = 356 bits (913), Expect = e-102 Identities = 179/422 (42%), Positives = 270/422 (63%), Gaps = 2/422 (0%) Query: 15 QGFTWITDPVKYLETAVKDYPDLFLANIVGEGGPTVFVQHPQAVQQILTGDRQNFIASGK 74 Q F +IT+PV Y + A Y D F A + G P + P A +QI+ + + + Sbjct: 14 QRFNYITNPVSYWQKAYSSYKDAFYAQGINFGKPLMVFYTPSAAKQIIENCQGDLTTTSF 73 Query: 75 THLLRPIIGNKSILGLDGNRHKKRRKLLLPSFHGDRIQAYGQLICDLTLQAFEQLTPNQI 134 L I G+ S L+G HKK RKLL+P+ HG I+ YG+LIC+L E L NQ Sbjct: 74 DSELTAIFGDSSFFILEGTNHKKMRKLLIPALHGKHIKTYGELICNLVNNLIENLPFNQS 133 Query: 135 FTGITVCKEISLQVILEAVYGLQDGDR--ALRQSVAKMADIFRSPLKTASLFFPWLQKDL 192 F+ + + +EIS+QV+++ ++G +R ++Q + M +F + + LFF +LQ+DL Sbjct: 134 FSALEIAQEISMQVMIKLLFGNYQQERYQKIKQLMINMVSLFAANVFGFPLFFKFLQQDL 193 Query: 193 GAWSPWGSFLRQRETIDQAIYEKIKERKANPDDSRQDILSLLISSKDEAGNSLTLLELRD 252 G SPWG+FL+QR I Q IY++I ER+ +P+ R DILSLL++++DE GN L EL Sbjct: 194 GLVSPWGNFLQQRRKIQQLIYQEIAERRNHPNQERTDILSLLMTAQDEKGNFLNDEELLG 253 Query: 253 ELMALTFAGHETTAIAMSWALYWIHHLPEVKRKLLAEIASLGKATDPVTIAKLPYLNAVC 312 +L++L F G+E+TA +++W+ Y ++ ++K KLL EI +LG + +P+++ LPYL+AVC Sbjct: 254 QLLSLLFTGNESTAASIAWSWYEVYRNSKIKEKLLEEINNLGDSPEPLSLFNLPYLSAVC 313 Query: 313 QETLRIYPVGMLTLPRVVQEKTEVLGYELEPGQLVAGCIYLLHQREDVYPDAKQFKPERF 372 ETLR YPV M +PR+V+ TE+ GY+L+ G LV Y+LH RED+Y ++FKPERF Sbjct: 314 NETLRKYPVTMFMIPRIVKNTTEINGYQLDKGMLVTVGTYILHHREDIYDQPEEFKPERF 373 Query: 373 LEREFSPYEFIPFGGGLRTCIGQAMAQFEVKLAIATILTNYDLELADNRPEFPKRLGARL 432 +E FS +EF+PFG G+R CIG +A +++KL +ATI++++ LEL + FPKR L Sbjct: 374 IEHRFSSFEFLPFGRGMRGCIGADIALYQMKLTLATIISHHRLELTNYGQIFPKRRNTIL 433 Query: 433 AP 434 P Sbjct: 434 TP 435 Lambda K H 0.321 0.139 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 510 Number of extensions: 25 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 453 Length of database: 444 Length adjustment: 33 Effective length of query: 420 Effective length of database: 411 Effective search space: 172620 Effective search space used: 172620 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory