Align spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized)
to candidate WP_011612685.1 TERY_RS15440 ABC transporter ATP-binding protein
Query= CharProtDB::CH_024626 (378 letters) >NCBI__GCF_000014265.1:WP_011612685.1 Length = 378 Score = 222 bits (565), Expect = 2e-62 Identities = 134/336 (39%), Positives = 199/336 (59%), Gaps = 24/336 (7%) Query: 15 SPLVQLAGIRKCFDGKEV--IPQLDLTINNGEFLTLLGPSGCGKTTVLRLIAGLETVDSG 72 S ++ L + K F + ++LT+ G+ L LLGPSGCGKTT+LR+IAG E SG Sbjct: 4 SVILYLESVSKKFSRSTTTAVQNVNLTLYQGDILGLLGPSGCGKTTLLRIIAGFEEPQSG 63 Query: 73 RIMLDNEDITH----VPAENRYVNTVFQSYALFPHMTVFENVAFGLRMQ-KTPAAEITPR 127 + ++ + + E R V VFQ YALFPH+TV +N+AFGL K + +I + Sbjct: 64 IVTINGRLVAGKHDWIVPEKRNVGMVFQDYALFPHLTVAKNIAFGLHNSGKKSSTQINHQ 123 Query: 128 VMEALRMVQLETFAQRKPHQLSGGQQQRVAIARAVVNKPRLLLLDESLSALDYKLRKQMQ 187 V + L +V L R PH+LSGGQQQRVA+ARA+ P L+LLDE LS LD ++R +++ Sbjct: 124 VRDVLELVGLSDLENRYPHELSGGQQQRVALARALAPNPALVLLDEPLSNLDVQVRIRLR 183 Query: 188 NELKALQRKLGITFVFVTHDQEEALTMSDRIVVMRDGRIEQDGTPREIYEEPKNLFVAGF 247 EL+ + + G + + VTHDQEEA+ +SDR+ VMR G +EQ GTP++IY EP + FVA F Sbjct: 184 QELRDILKNAGASGIIVTHDQEEAMAISDRVAVMRAGSVEQFGTPKDIYTEPASKFVAEF 243 Query: 248 IGEINMFNATVIERLDEQRVRA------NVEGRECNIYVNFAVEPGQKLHVLLRPEDLRV 301 + + N A +++ E V A NV G E + +++ +L +++R EDL + Sbjct: 244 VTQANFLPAHRHDQVWETEVGAFELTNNNVFGGEID-----SLDEFDRLELMIRQEDLIL 298 Query: 302 EEINDDNHAEGLIGYVRERNYKGMTLESVVELENGK 337 + N EG I +R+R + G ++ E+GK Sbjct: 299 KADN-----EGCI-VIRDRQFLGREFRYCLQTESGK 328 Lambda K H 0.319 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 344 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 378 Length adjustment: 30 Effective length of query: 348 Effective length of database: 348 Effective search space: 121104 Effective search space used: 121104 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory