Align 3-hydroxyacyl-CoA dehydrogenase IvdG; EC 1.1.1.35 (characterized, see rationale)
to candidate WP_011612874.1 TERY_RS16490 3-oxoacyl-[acyl-carrier-protein] reductase
Query= uniprot:Q8EGC1 (252 letters) >NCBI__GCF_000014265.1:WP_011612874.1 Length = 252 Score = 154 bits (388), Expect = 2e-42 Identities = 97/254 (38%), Positives = 150/254 (59%), Gaps = 20/254 (7%) Query: 3 LKDKVVVITGGAGGLGLAMAHNFAQAGAKLAL-IDVDQDKLERACADLGSSTEVQGYAL- 60 LK KV ++TG + G+G A A A GA + + D E A++ ++ G AL Sbjct: 11 LKGKVAIVTGASRGIGRATALALAMEGANVVVNYAKSSDTAEEVVAEIVAAGG-NGLALQ 69 Query: 61 -DITDEEDVVAGFAYILEDFGKINVLVNNAGILRDGMLVKAKDGKVTDRMSFDQFQSVIN 119 D++ E+V ++E + ++++LVNNAGI RD +L+ RM + +QSVI+ Sbjct: 70 ADVSQVEEVDNLIKEVMEKWSRVDILVNNAGITRDTLLL---------RMKLEDWQSVID 120 Query: 120 VNLTGTFLCGREAAAAMIESGQAGVIVNISSLA-KAGNVGQSNYAASKAGVAAMSVGWAK 178 +NLTG FLC R + M++ ++G I+N++S++ + GN GQ+NY+A+KAGV + AK Sbjct: 121 LNLTGVFLCTRAVSKIMLKQ-KSGRIINVASVSGQMGNPGQANYSAAKAGVIGFTKTVAK 179 Query: 179 ELARYNIRSAAVAPGVIATEMTAAMKPEALERLEKLVPVGRLGHAEEIASTVRFIIEND- 237 ELA I + VAPG I T+MT +K E + K +P+GR G EE+A +RF+ +D Sbjct: 180 ELANRGITANVVAPGFIETDMTKDLKNS--EEIIKFIPLGRYGKPEEVAGMIRFLAADDA 237 Query: 238 --YVNGRVFEVDGG 249 Y+ +VF VDGG Sbjct: 238 ASYITAQVFNVDGG 251 Lambda K H 0.317 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 252 Length adjustment: 24 Effective length of query: 228 Effective length of database: 228 Effective search space: 51984 Effective search space used: 51984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory