Align agmatinase (EC 3.5.3.11) (characterized)
to candidate WP_011613157.1 TERY_RS18140 agmatinase
Query= BRENDA::Q57757 (284 letters) >NCBI__GCF_000014265.1:WP_011613157.1 Length = 303 Score = 149 bits (376), Expect = 7e-41 Identities = 102/276 (36%), Positives = 153/276 (55%), Gaps = 15/276 (5%) Query: 18 YEEAEGVIFSIPYDETTSFKPGAREGGNAIRTASWGLETYSPILDRD--LAELKYCDLKD 75 Y A+ VI IPY+ TT+++ G G + AS LE Y LDR+ L Y Sbjct: 21 YTTAKVVIVPIPYEATTTYRRGCVNGPAVLLNASQQLECYDEELDRETGLEVGIYTHEPI 80 Query: 76 LDLYGSQE----EIFGTIHSVSREILKENKKIIVFGGEHSITYPIIKAVKDIYDD--FIV 129 D ++ ++ +++ + K +I GGEHSIT I+KA K +Y D F V Sbjct: 81 ADTRNGKKITPLDMLKVTQETVEKLVSDGKFVIAIGGEHSITNGIVKAYKKLYFDEPFTV 140 Query: 130 IQFDAHCDLRDEYLGNKLSHACVMRRVYELTKNIFQFGIRSGDKEEWDLARKNNLYL--- 186 IQ DAH DLR EY G+ +HACVMRR++E+ + Q GIR+ KEE DL + NL + Sbjct: 141 IQIDAHGDLRYEYEGSIYNHACVMRRIFEMGLPMVQIGIRAICKEEADLIKDKNLTVFKA 200 Query: 187 KMDLMNKDDLEYIKS--LDKPIYVTIDIDVLDPAYAPGTGTPEPCGFSTRELFNSLYLLE 244 + + D +E + S K +++TID+D +DP PG GTPEP G + L L + Sbjct: 201 REIAIQPDWMERVISSIQTKNVFLTIDLDGIDPTLIPGVGTPEPGGLNWYSLTTFLRRIF 260 Query: 245 EVKDKIIGFDIVEVSPIYDIANITAITAAKIARELM 280 E+ +++G DI+E++PI D + ++ TAAK+ +L+ Sbjct: 261 ELY-QVLGCDIMELAPITD-SVVSEFTAAKLVYKLV 294 Lambda K H 0.321 0.141 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 284 Length of database: 303 Length adjustment: 26 Effective length of query: 258 Effective length of database: 277 Effective search space: 71466 Effective search space used: 71466 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_011613157.1 TERY_RS18140 (agmatinase)
to HMM TIGR01230 (speB: agmatinase (EC 3.5.3.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01230.hmm # target sequence database: /tmp/gapView.25268.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01230 [M=275] Accession: TIGR01230 Description: agmatinase: agmatinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.7e-91 290.7 0.0 8e-91 290.4 0.0 1.0 1 lcl|NCBI__GCF_000014265.1:WP_011613157.1 TERY_RS18140 agmatinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000014265.1:WP_011613157.1 TERY_RS18140 agmatinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 290.4 0.0 8e-91 8e-91 5 274 .. 16 295 .. 12 296 .. 0.93 Alignments for each domain: == domain 1 score: 290.4 bits; conditional E-value: 8e-91 TIGR01230 5 eseaeyeeAevvivgiPydattsyrpGsrhgpeaireastnLeayseeldrdlal.......lkvvDag 66 e e++y A+vviv+iPy+att yr+G+ gp+ +++as++Le y+eeldr+ +l +++D+ lcl|NCBI__GCF_000014265.1:WP_011613157.1 16 EIEPDYTTAKVVIVPIPYEATTTYRRGCVNGPAVLLNASQQLECYDEELDRETGLevgiythEPIADTR 84 56899*********************************************8877765666666777777 PP TIGR01230 67 dlplaaGdaremvekieevveelleegkfvvaiGGeHsitlpvirAvkkkf..eklavvqfDAHtDlrd 133 + + + + +m++ +e+ve+l+ +gkfv+aiGGeHsit ++++A kk + e+++v+q+DAH+Dlr lcl|NCBI__GCF_000014265.1:WP_011613157.1 85 NGKKIT--PLDMLKVTQETVEKLVSDGKFVIAIGGEHSITNGIVKAYKKLYfdEPFTVIQIDAHGDLRY 151 766643..45899999*********************************654568************** PP TIGR01230 134 efegeklshacvmrrvlelglnvlqigiRsgikeeadlarennikvlk.relede...iaevlakvldk 198 e+eg+ ++hacvmrr++e+gl+++qigiR+++keeadl++++n+ v+k re++ + +++v+ ++ +k lcl|NCBI__GCF_000014265.1:WP_011613157.1 152 EYEGSIYNHACVMRRIFEMGLPMVQIGIRAICKEEADLIKDKNLTVFKaREIAIQpdwMERVISSIQTK 220 ************************************************9**9977777999******** PP TIGR01230 199 pvyvtiDiDvlDPafaPGvgtpepgGltskellklfvlaekekkvvGlDvvEvaPvydssevtaltaak 267 +v++tiD+D++DP+ +PGvgtpepgGl+++ l ++++ ++ +v G+D++E+aP + s+v+++taak lcl|NCBI__GCF_000014265.1:WP_011613157.1 221 NVFLTIDLDGIDPTLIPGVGTPEPGGLNWYSLTTFLRRIFELYQVLGCDIMELAP-ITDSVVSEFTAAK 288 *******************************************************.66799******** PP TIGR01230 268 lalelll 274 l+++l++ lcl|NCBI__GCF_000014265.1:WP_011613157.1 289 LVYKLVG 295 ****986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (275 nodes) Target sequences: 1 (303 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 11.32 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory