Align 2-methylisocitrate lyase; 2-MIC; MICL; EC 4.1.3.30; (2R,3S)-2-methylisocitrate lyase (uncharacterized)
to candidate WP_011613594.1 TERY_RS20585 carboxyvinyl-carboxyphosphonate phosphorylmutase
Query= curated2:Q9YFM7 (308 letters) >NCBI__GCF_000014265.1:WP_011613594.1 Length = 291 Score = 194 bits (494), Expect = 2e-54 Identities = 111/284 (39%), Positives = 172/284 (60%), Gaps = 5/284 (1%) Query: 13 GLVLRELIEKRDIVVAPGVYNPAVALLAERMGFEALYLSGAAITGS-LAMPDLGLITLSE 71 G LR+++E+ +V PGVY+ A + E++GF ++ SG I+GS L PD G IT +E Sbjct: 4 GKKLRQILEQPGALVLPGVYDCIGAKIVEQIGFPVVFTSGFGISGSTLGRPDYGFITATE 63 Query: 72 LAMFTSYITRVVRVPVIVDADTGFGEAINVERTVRELERAGAAAIQIEDQVMPKKCGHLQ 131 + IT V +P++ D DTG+G +NV RTV ++ G A I +EDQ PKKCGH Q Sbjct: 64 MLYAIRRITESVNIPLVADIDTGYGNPLNVIRTVTDIVNMGVAGIILEDQEWPKKCGHFQ 123 Query: 132 GKALISPEDMVKKIIAAVGARRDA--LIVARTDARGVEGFEKAVERAQLYVEAGADIIFP 189 GK +I + V+KI AAV AR D+ +I+ARTDAR G ++A++R + EAGAD++F Sbjct: 124 GKRVIPMAEHVEKIKAAVHARGDSGLVIIARTDARAPLGLDEAIKRGRACAEAGADVVFI 183 Query: 190 EALTSLEEFREFARRVK-APLLANMTEFGKTPYITVDQFREAGYKIVIFPVTTFRASLKA 248 EA SLE+ + A + L ANM E GKTP ++ + E G+KIV++P++ ++ +A Sbjct: 184 EAPQSLEDLQAIATAFEDVYLFANMIEGGKTPVLSGQELAEMGFKIVVYPLSGLFSATQA 243 Query: 249 SETVLREIMEKGTQKDILDKLYTRTEFYDLIGYHDYEKRDAEVS 292 R++ E GT + D + + +F ++I Y++ + + S Sbjct: 244 MINCYRQLFENGTTAGLQD-IVSFQDFENIIEVPKYQELEQKFS 286 Lambda K H 0.321 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 252 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 291 Length adjustment: 27 Effective length of query: 281 Effective length of database: 264 Effective search space: 74184 Effective search space used: 74184 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory