Align deoxyribose-phosphate aldolase (EC 4.1.2.4) (characterized)
to candidate WP_011613895.1 TERY_RS22245 deoxyribose-phosphate aldolase
Query= BRENDA::Q877I0 (224 letters) >NCBI__GCF_000014265.1:WP_011613895.1 Length = 226 Score = 163 bits (412), Expect = 3e-45 Identities = 88/214 (41%), Positives = 139/214 (64%), Gaps = 6/214 (2%) Query: 5 EIARYIDQTNLKPYATKEDIIKLCDEAIEYGFYAVCVNPYRVKLAKDYLREKNADVKVAS 64 +IA +ID + L AT E++ K C EA ++ F +VCV P V+ D L K+ KV++ Sbjct: 9 DIAPFIDHSLLTITATPEEVSKFCIEADKFRFPSVCVYPCHVRKVVDLLSTKSP--KVST 66 Query: 65 VIGFPLGATPTEVKVFEAKRALEDGADELDMVINIGALKDKDYEYVKNDIAEVVKVAHER 124 VI FP G ++ K++EA A+E+GA ELD+++N+ +K + + +IAE+ E Sbjct: 67 VINFPNGTATSKTKLYEALEAVENGASELDVMVNLTYIKTGEMSQLHREIAEI---REET 123 Query: 125 GAKVKVIIETCYLTEEEKVKACELAKEAGADFVKTSTGFGTGGATVEDVRLMRKVVGPEM 184 G VK I+E LT++EK E+ +AG F+ T+TG+ GGATV DV+L++++ + Sbjct: 124 GKTVKAILEMALLTKDEKYLVIEVLMDAGVAFIATNTGW-YGGATVADVKLLKEITKANV 182 Query: 185 GVKAAGGIRTYEQALEMIEAGANRIGTSSGVKIV 218 G+KAAGGI+TYEQA+ ++ AGA R+GTS G++++ Sbjct: 183 GIKAAGGIKTYEQAVSLVLAGATRLGTSRGLELL 216 Lambda K H 0.315 0.134 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 224 Length of database: 226 Length adjustment: 22 Effective length of query: 202 Effective length of database: 204 Effective search space: 41208 Effective search space used: 41208 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
Align candidate WP_011613895.1 TERY_RS22245 (deoxyribose-phosphate aldolase)
to HMM TIGR00126 (deoC: deoxyribose-phosphate aldolase (EC 4.1.2.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00126.hmm # target sequence database: /tmp/gapView.7547.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00126 [M=211] Accession: TIGR00126 Description: deoC: deoxyribose-phosphate aldolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-66 209.7 1.1 1.9e-66 209.5 1.1 1.0 1 lcl|NCBI__GCF_000014265.1:WP_011613895.1 TERY_RS22245 deoxyribose-phospha Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000014265.1:WP_011613895.1 TERY_RS22245 deoxyribose-phosphate aldolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 209.5 1.1 1.9e-66 1.9e-66 2 209 .. 10 215 .. 9 217 .. 0.98 Alignments for each domain: == domain 1 score: 209.5 bits; conditional E-value: 1.9e-66 TIGR00126 2 lakliDhtalkadtteedietlcaeAkkykfaavcvnpsyvslAkelLkgteveictvvgFPlGastte 70 +a +iDh+ l+ +t+e++++ c eA k++f +vcv+p v+ ++lL ++ +++tv++FP G+ t++ lcl|NCBI__GCF_000014265.1:WP_011613895.1 10 IAPFIDHSLLTITATPEEVSKFCIEADKFRFPSVCVYPCHVRKVVDLLSTKSPKVSTVINFPNGTATSK 78 6889***************************************************************** PP TIGR00126 71 vkllEakeaieeGAdEvDvviniaalkdkneevviedikavveacakvllKvilEtalLtdeekkkAse 139 +kl+Ea ea+e+GA E+Dv++n++ +k ++ ++i+ + e + + ++K+ilE+alLt++ek e lcl|NCBI__GCF_000014265.1:WP_011613895.1 79 TKLYEALEAVENGASELDVMVNLTYIKTGEMSQLHREIAEIREET-GKTVKAILEMALLTKDEKYLVIE 146 *********************************************.999******************** PP TIGR00126 140 isieagadfvKtstgfsakgAtvedvrlmkkvvgdevgvKasGGvrtaedalalieagaerigasaava 208 + ++ag++f+ t tg+ +gAtv+dv+l+k++ + +vg+Ka+GG++t e+a +l+ aga+r+g+s++ + lcl|NCBI__GCF_000014265.1:WP_011613895.1 147 VLMDAGVAFIATNTGWY-GGATVADVKLLKEITKANVGIKAAGGIKTYEQAVSLVLAGATRLGTSRGLE 214 ****************9.************************************************987 PP TIGR00126 209 i 209 + lcl|NCBI__GCF_000014265.1:WP_011613895.1 215 L 215 6 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (211 nodes) Target sequences: 1 (226 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 7.66 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory